KEGG   Homo sapiens (human): 845
Entry
845               CDS       T01001                                 

Gene name
CASQ2, PDIB2
Definition
(RefSeq) calsequestrin 2
  KO
K23445  calsequestrin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
Disease
H01019  Catecholaminergic polymorphic ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    845 (CASQ2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    845 (CASQ2)
SSDB
Motif
Pfam: Calsequestrin Thioredoxin_6
Other DBs
NCBI-GeneID: 845
NCBI-ProteinID: NP_001223
OMIM: 114251
HGNC: 1513
Ensembl: ENSG00000118729
Vega: OTTHUMG00000011970
Pharos: O14958(Tbio)
UniProt: O14958
Structure
PDB: 
2VAF

Position
1p13.1
AA seq 399 aa
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPV
SSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYK
AFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEF
VKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaagagaactcacttgtttattgtggggatttattttctgtcctcttgcagggcagaa
gaggggcttaatttccccacatatgatgggaaggaccgagtggtaagtctttccgagaag
aacttcaagcaggttttaaagaaatatgacttgctttgcctctactaccatgagccggtg
tcttcagataaggtcacgcaaaaacagttccaactgaaagaaatcgtgcttgagcttgtg
gcccaggtccttgaacataaagctataggctttgtgatggtggatgccaagaaagaagcc
aagcttgccaagaaactgggttttgatgaagaaggaagcctgtatattcttaagggtgat
cgcacaatagagtttgatggcgagtttgcagctgatgtcttggtggagttcctcttggat
ctaattgaagacccagtggagatcatcagcagcaaactggaagtccaagccttcgaacgc
attgaagactacatcaaactcattggctttttcaagagtgaggactcagaatactacaag
gcttttgaagaagcagctgaacacttccagccttacatcaaattctttgccacctttgac
aaaggggttgcaaagaaattatctttgaagatgaatgaggttgacttctatgagccattt
atggatgagcccattgccatccccaacaaaccttacacagaagaggagctggtggagttt
gtgaaggaacaccaaagacccactctacgtcgcctgcgcccagaagaaatgtttgaaaca
tgggaagatgatttgaatgggatccacattgtggcctttgcagagaagagtgatccagat
ggctacgaattcctggagatcctgaaacaggttgcccgggacaatactgacaaccccgat
ctgagcatcctgtggatcgacccggacgactttcctctgctcgttgcctactgggagaag
actttcaagattgacctattcaggccacagattggggtggtgaatgtcacagatgctgac
agtgtctggatggagattccagatgatgacgatcttccaactgctgaggagctggaggac
tggattgaggatgtgctttctggaaagataaacactgaagatgatgatgaagatgatgat
gatgatgataattctgatgaagaggataatgatgacagtgatgacgatgatgatgaatag

DBGET integrated database retrieval system