KEGG   Homo sapiens (human): 845Help
Entry
845               CDS       T01001                                 

Gene name
CASQ2, PDIB2
Definition
(RefSeq) calsequestrin 2
  KO
K23445  calsequestrin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
Disease
H01019  Catecholaminergic polymorphic ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    845 (CASQ2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    845 (CASQ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calsequestrin Thioredoxin_6 SDA1
Motif
Other DBs
NCBI-GeneID: 845
NCBI-ProteinID: NP_001223
OMIM: 114251
HGNC: 1513
Ensembl: ENSG00000118729
Vega: OTTHUMG00000011970
Pharos: O14958(Tbio)
UniProt: O14958
Structure
PDB: 

Position
1p13.1
AA seq 399 aa AA seqDB search
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPV
SSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGD
RTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYK
AFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEF
VKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPD
LSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELED
WIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaactcacttgtttattgtggggatttattttctgtcctcttgcagggcagaa
gaggggcttaatttccccacatatgatgggaaggaccgagtggtaagtctttccgagaag
aacttcaagcaggttttaaagaaatatgacttgctttgcctctactaccatgagccggtg
tcttcagataaggtcacgcaaaaacagttccaactgaaagaaatcgtgcttgagcttgtg
gcccaggtccttgaacataaagctataggctttgtgatggtggatgccaagaaagaagcc
aagcttgccaagaaactgggttttgatgaagaaggaagcctgtatattcttaagggtgat
cgcacaatagagtttgatggcgagtttgcagctgatgtcttggtggagttcctcttggat
ctaattgaagacccagtggagatcatcagcagcaaactggaagtccaagccttcgaacgc
attgaagactacatcaaactcattggctttttcaagagtgaggactcagaatactacaag
gcttttgaagaagcagctgaacacttccagccttacatcaaattctttgccacctttgac
aaaggggttgcaaagaaattatctttgaagatgaatgaggttgacttctatgagccattt
atggatgagcccattgccatccccaacaaaccttacacagaagaggagctggtggagttt
gtgaaggaacaccaaagacccactctacgtcgcctgcgcccagaagaaatgtttgaaaca
tgggaagatgatttgaatgggatccacattgtggcctttgcagagaagagtgatccagat
ggctacgaattcctggagatcctgaaacaggttgcccgggacaatactgacaaccccgat
ctgagcatcctgtggatcgacccggacgactttcctctgctcgttgcctactgggagaag
actttcaagattgacctattcaggccacagattggggtggtgaatgtcacagatgctgac
agtgtctggatggagattccagatgatgacgatcttccaactgctgaggagctggaggac
tggattgaggatgtgctttctggaaagataaacactgaagatgatgatgaagatgatgat
gatgatgataattctgatgaagaggataatgatgacagtgatgacgatgatgatgaatag

DBGET integrated database retrieval system