KEGG   Homo sapiens (human): 8450Help
Entry
8450              CDS       T01001                                 

Gene name
CUL4B, CUL-4B, MRXHF2, MRXS15, MRXSC, SFM2
Definition
(RefSeq) cullin 4B
  KO
K10609  cullin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
hsa05170  Human immunodeficiency virus 1 infection
Module
hsa_M00385  Cul4-DDB1-DDB2 complex
hsa_M00386  Cul4-DDB1-CSA complex
Network
N00456  HIV Vpr to CDC25-cell cycle G2M
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8450 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    8450 (CUL4B)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    8450 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8450 (CUL4B)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8450 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8450 (CUL4B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     8450 (CUL4B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      8450 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      8450 (CUL4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8450 (CUL4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Motif
Other DBs
NCBI-GeneID: 8450
NCBI-ProteinID: NP_003579
OMIM: 300304
HGNC: 2555
Ensembl: ENSG00000158290
Vega: OTTHUMG00000022302
Pharos: Q13620(Tbio)
UniProt: Q13620
Structure
PDB: 

Position
Xq24
AA seq 913 aa AA seqDB search
MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLN
SSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLR
FEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSS
TTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEEL
YQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQM
IMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNG
EAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLF
SRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKF
INAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGK
DVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMI
QFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK
LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR
TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME
RDKENPNQYNYIA
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcacagtcatctggatcaggagatgggaatgatgatgaggctactacctctaaa
gacggtggtttttcttcccccagtccctcagctgctgctgctgctcaggaggtcagatct
gccactgatggtaataccagcaccactccgcccacctctgccaagaagagaaagttaaac
agcagcagcagtagcagcagtaacagtagtaacgagagagaagactttgattccacctct
tcctcctcttccactcctcctttacaacccagggattcggcatccccttcaacctcgtcc
ttctgcctgggggtttcagtggctgcttccagccacgtaccgatacagaagaagctgcgt
tttgaagacaccctggagtttgtagggtttgatgcgaagatggctgaggaatcctcctcc
tcctcctcctcatcttcaccaactgctgcaacatctcagcagcagcaacttaaaaataag
agtatattaatctcttctgtggcttcggtgcatcatgcaaacggcctagccaaatcttct
accaccgtctctagctttgctaacagcaaacctggctctgctaagaagttagtgatcaag
aactttaaagataagcctaaattaccagaaaactacacagatgaaacctggcaaaaactg
aaagaagcagtggaagctattcagaatagtacttcaattaagtacaatttagaagaactc
taccaggctgtagaaaatctctgttcttacaagatttctgcaaacttgtacaaacagctg
agacagatctgcgaagatcacatcaaagcacagattcatcaattcagagaggattcattg
gatagcgttctttttttaaagaagattgatagatgctggcaaaaccattgcagacaaatg
atcatgatcaggagcatttttttgtttctggatagaacttacgttcttcagaattcaatg
ctaccctccatttgggacatgggactggagttatttagggctcatattataagtgatcag
aaagtgcagaataagacaattgatggcattcttctcttgattgagagggaaaggaatggt
gaagcaattgatagaagtttacttcgaagccttttaagcatgctgtctgatttgcaaatt
tatcaagattcttttgaacaacgatttttggaagaaactaaccggctctatgcagctgaa
ggccaaaaattaatgcaagaaagagaggttcctgaatatctacatcatgttaacaaacgt
ctagaagaagaagcagacagacttattacttacttagatcagaccacccagaagtcatta
attgctactgtagaaaaacaacttctaggtgaacacttaacagcaattcttcagaaaggt
ttaaataacctccttgatgaaaaccgaattcaagatttgtctcttctgtatcagctcttc
agtagagttcgaggtggagttcaggttcttttgcagcagtggatcgaatatatcaaggca
tttggcagcactattgtaattaatcctgaaaaagataaaaccatggttcaagaattgctg
gattttaaagataaggttgaccatataattgatatctgctttctgaagaatgagaaattt
atcaatgccatgaaagaagcatttgaaacgttcattaacaaaagaccaaataaaccagct
gaacttatagctaagtatgtagattcaaaacttcgtgcaggcaacaaagaagctacagat
gaagaacttgagaaaatgttggataaaattatgatcatatttagatttatctatggcaag
gatgtttttgaggccttctataagaaagatttagccaagcgcctgttagtcggaaagagt
gcatctgtagatgctgaaaaatcaatgctgtccaaacttaaacatgaatgcggagctgct
ttcaccagcaaacttgaaggaatgtttaaagacatggaactttctaaagacatcatgatt
cagttcaaacagtatatgcagaatcagaatgttccgggaaatattgagttaactgtgaat
atcctgacaatgggctattggccgacatatgtgcctatggaagttcatttaccaccagag
atggtaaaacttcaggagattttcaagacattttacctaggcaaacatagtggcaggaaa
cttcagtggcagtcaaccctaggacactgtgtgttaaaagcagaatttaaagagggtaaa
aaggaactccaggtctctctttttcaaacactggtgctgctaatgtttaatgagggagag
gagttcagtttagaagagatcaagcaggcaactggaatagaggatggagagttaaggaga
acactgcagtcattagcctgtggcaaagctagagttctggcgaaaaatccaaagggcaaa
gacattgaagatggtgacaagttcatttgtaatgatgatttcaaacataaacttttcagg
ataaagatcaatcaaatccagatgaaagaaacggttgaagaacaagcaagcactacagaa
agagtatttcaagacagacagtatcaaattgatgctgcaattgttcgaattatgaagatg
agaaagacacttagccacaatctccttgtttcagaagtgtacaaccagttgaaatttcca
gtaaagcctgctgatcttaagaagagaatagaatctttaattgaccgggactacatggaa
agagataaagaaaatccaaaccagtacaactatattgcatag

DBGET integrated database retrieval system