KEGG   Homo sapiens (human): 84501Help
Entry
84501             CDS       T01001                                 

Gene name
SPIRE2, Spir-2
Definition
(RefSeq) spire type actin nucleation factor 2
  KO
K02098  spire
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: KIND PrmA
Motif
Other DBs
NCBI-GeneID: 84501
NCBI-ProteinID: NP_115827
OMIM: 609217
HGNC: 30623
Ensembl: ENSG00000204991
Vega: OTTHUMG00000173039
Pharos: Q8WWL2(Tdark)
UniProt: Q8WWL2
Structure
PDB: 

Position
16q24.3
AA seq 714 aa AA seqDB search
MARAGSCGGAAAGAGRPEPWELSLEEVLKAYEQPLNEEQAWAVCFQGCRGLRGSPGRRLR
DTGDLLLRGDGSVGAREPEAAEPATMVVPLASSEAQTVQSLGFAIYRALDWGLDESEERE
LSPQLERLIDLMANNDSEDSGCGAADEGYGGPEEEEEAEGVPRSVRTFAQAMRLCAARLT
DPRGAQAHYQAVCRALFVETLELRAFLARVREAKEMLQKLREDEPHLETPRAELDSLGHT
DWARLWVQLMRELRRGVKLKKVQEQEFNPLPTEFQLTPFEMLMQDIRARNYKLRKVMVDG
DIPPRVKKDAHELILDFIRSRPPLKQVSERRLRPLPPKQRSLHEKILEEIKQERRLRPVR
GEGWAARGFGSLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEM
NTSEEEESPCGEVTLKRDRSFSEHDLAQLRSEVASGLQSATHPPGGTEPPRPRAGSAHVW
RPGSRDQGTCPASVSDPSHPLLSNRGSSGDRPEASMTPDAKHLWLEFSHPVESLALTVEE
VMDVRRVLVKAEMEKFLQNKELFSSLKKGKICCCCRAKFPLFSWPPSCLFCKRAVCTSCS
IKMKMPSKKFGHIPVYTLGFESPQRVSAAKTAPIQRRDIFQSLQGPQWQSVEEAFPHIYS
HGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQTQSLYIPNTRTLDFK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggcgggcagctgcggcggcgccgcggcgggcgcagggcggccggagccctgg
gagctgtccctggaggaggtgctgaaggcctacgagcagccgctcaacgaggagcaggcg
tgggccgtgtgcttccagggctgccgcgggctgcggggctcgccgggccggcgcctgcgg
gataccggggacctcctgctgcgcggggacggctcggtcggggcgcgggagcccgaggcc
gcggaacctgcaaccatggtcgtgccactagccagctcggaagcccagaccgtgcagtcc
ctcggcttcgccatctaccgcgcgctggactgggggctggacgagagcgaggagcgcgaa
ctcagccctcagctggagcggctcatcgacctcatggccaacaacgacagcgaggacagc
ggctgcggtgccgccgatgagggctacgggggtcccgaggaggaggaggaggccgagggc
gtcccccgcagcgtgcgcacctttgcccaggccatgcggctgtgcgcggcgcggctgacc
gacccccggggcgcacaggcgcattaccaggccgtgtgccgcgcgctcttcgtggagacg
ctggagctgcgggccttcctggccagggtccgggaggccaaggagatgctgcagaagctt
cgggaggacgagccgcatctggagacgcctcgggcagagctggacagcctgggtcacaca
gactgggcccgactgtgggttcagctcatgcgggagctccgccgcggagtgaagctgaag
aaggtgcaagagcaggagttcaaccccctccccaccgagttccagctcacgcccttcgag
atgctgatgcaggacatccgggcccggaactacaagctgcgcaaggtcatggtggatggg
gacatcccgccccgggtgaagaaggacgctcacgagctcatcctggactttatccgctca
cggcctccactgaagcaggtctctgagaggcggctgcgcccgttgccaccaaagcaaagg
tccctgcatgagaagatcctggaggagatcaagcaggagcggaggctgcgcccggtgcgg
ggcgagggctgggctgcccgcgggtttggctctctgccctgcatcctcaacgcctgctcc
ggagatgccaagtccacctcctgcatcaacctgtcagtcacagatgctgggggcagcgcc
cagcgcccgcggccccgcgtgctgctcaaggcgcctaccttggctgaaatggaagagatg
aatacatctgaggaagaagagtctccgtgtggggaggtgacgctgaaacgggaccgctcc
ttctcagagcatgacctggcccagctccgaagtgaggtggcctctggcctgcagtcggcc
acccaccccccaggagggacggagccaccacggccccgagctggcagtgcgcatgtgtgg
aggcccggctcccgagaccagggtacctgtcccgcgagtgtctctgaccccagccacccc
ctactcagcaaccggggctcctcgggggacagacccgaggcctccatgacccccgatgcc
aaacacctgtggctggagttcagccaccccgtggagagcctggcgctgactgtggaagag
gtgatggacgtgcgccgtgtgctggtgaaggccgagatggaaaagtttttgcagaacaag
gagctcttcagcagtctgaagaaggggaagatttgctgctgctgccgggccaagttcccg
ctgttctcgtggccgcccagctgtctcttctgcaagagagccgtctgcacttcctgtagc
ataaagatgaagatgccttctaagaaatttggacacatccctgtctacacactgggcttt
gagagtcctcagagggtatcagctgccaaaaccgcgccaatccagagaagagacatcttt
cagtctctgcaagggccacagtggcagagcgtggaggaggcgttcccccacatctactcc
cacggctgtgtcctgaaggatgtctgcagtgagtgcaccagctttgtggcagacgtggtg
cgttccagccgcaagagcgtggacgtcctcaacactacgccacgacgcagtcgccagacc
caatccctctacatccctaacaccaggactcttgacttcaagtga

DBGET integrated database retrieval system