KEGG   Homo sapiens (human): 84514
Entry
84514             CDS       T01001                                 

Gene name
GHDC, D11LGP1, LGP1
Definition
(RefSeq) GH3 domain containing
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GH3
Other DBs
NCBI-GeneID: 84514
NCBI-ProteinID: NP_115873
OMIM: 608587
HGNC: 24438
Ensembl: ENSG00000167925
Vega: OTTHUMG00000180108
Pharos: Q8N2G8(Tbio)
UniProt: Q8N2G8 A0A024R1Y7
Position
17q21.2
AA seq 530 aa
MLLWPLLLLLLLLPTLALLRQQRSQDARLSWLAGLQHRVAWGALVWAATWQRRRLEQSTL
HVHQSQQQALRWCLQGAQRPHCSLRRSTDISTFRNHLPLTKASQTQQEDSGEQPLPPTSN
QDLGEASLQATLLGLAALNKAYPEVLAQGRTARVTLTSPWPRPLPWPGNTLGQVGTPGTK
DPRALLLDALRSPGLRALEAGTAVELLDVFLGLETDGEELAGAIAAGNPGAPLRERAAEL
REALEQGPRGLALRLWPKLQVVVTLDAGGQAEAVAALGALWCQGLAFFSPAYAASGGVLG
LNLQPEQPHGLYLLPPGAPFIELLPVKEGTQEEAASTLLLAEAQQGKEYELVLTDRASLT
RCRLGDVVRVVGAYNQCPVVRFICRLDQTLSVRGEDIGEDLFSEALGRAVGQWAGAKLLD
HGCVESSILDSSAGSAPHYEVFVALRGLRNLSEENRDKLDHCLQEASPRYKSLRFWGSVG
PARVHLVGQGAFRALRAALAACPSSPFPPAMPRVLRHRHLAQCLQERVVS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgctgctgtggccactgctgctgctgctgctgctgctgccaacattggccctgctcagg
cagcagcggtcccaggatgccaggctgtcctggcttgctggcctccagcaccgagtggca
tggggggccctggtctgggcagccacctggcagcggcggaggctggagcagagcacgctc
catgtgcaccagagccagcagcaggccctgaggtggtgtctacagggagcccagcgcccc
cactgttccctcagaaggagcacagacataagcaccttccggaatcatctccctctgacc
aaggccagccagacccagcaggaagacagtggagagcagccactgcccccgacctcaaac
caggaccttggggaggcctctctgcaggccaccttgctgggtctggcagccctaaacaag
gcctacccagaagtgctggctcagggacgcactgcccgtgtgacgcttacatccccttgg
ccccgacccctgccttggcctgggaataccctgggccaggtgggcacccctggaaccaag
gaccctagggccctgctgctggacgcactgaggtccccagggctgagggcactggaggct
gggacggctgtcgaacttctggatgttttcttgggcctggagactgatggtgaagagcta
gctggggcgatagctgccgggaaccctggagcgcctctccgtgaacgggcagctgagctc
cgggaggccctagagcaggggccacggggactggcccttcggctctggccaaagctgcag
gtggtggtgactctggatgcaggaggccaggccgaggctgtggctgccctcggggccttg
tggtgccaaggactagccttcttctctcctgcttatgctgcctcgggaggggtgctgggc
ctaaacctacagccagagcagccccatgggctctaccttctgccccctggggcccccttt
atcgagctgctcccagtcaaggaaggcacccaggaggaagctgcctccaccctccttttg
gccgaggcccagcagggcaaggagtatgagctggtgctgacggaccgcgccagcctcacc
aggtgccgcctgggtgatgtggtgcgagtggttggtgcctacaatcagtgtccagtcgtc
aggttcatctgcaggctggaccagaccctgagtgtgcgaggggaagatattggtgaagac
ctgttctctgaggccctgggccgggcagtggggcagtgggcgggggccaagctgctggac
catggctgtgtggagagcagcattctggattcctctgcgggctctgctccccactacgag
gtgtttgtggcgctgagggggctgaggaatctgtcagaggaaaatcgagacaagctggac
cactgccttcaggaagcctctccccgctacaagtccctgcggttctggggcagcgtgggc
cctgccagagtccacctggtggggcagggagccttccgagcactccgggcagccctcgct
gcctgcccctcctcccccttcccccctgcgatgccccgggtccttcggcacaggcacctg
gcccagtgtctgcaggagagggtggtgtcctga

DBGET integrated database retrieval system