KEGG   Homo sapiens (human): 84515
Entry
84515             CDS       T01001                                 

Gene name
MCM8, C20orf154, POF10, dJ967N21.5
Definition
(RefSeq) minichromosome maintenance 8 homologous recombination repair factor
  KO
K10737  DNA helicase MCM8 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00627  Premature ovarian failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    84515 (MCM8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     84515 (MCM8)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   Other initiation factors
    84515 (MCM8)
SSDB
Motif
Pfam: MCM MCM_lid MCM_OB Mg_chelatase AAA_5 AAA_3 NTPase_1 AAA_22 AAA AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 84515
NCBI-ProteinID: NP_001268449
OMIM: 608187
HGNC: 16147
Ensembl: ENSG00000125885
Vega: OTTHUMG00000031822
Pharos: Q9UJA3(Tbio)
UniProt: Q9UJA3
Position
20p12.3
AA seq 840 aa
MNGEYRGRGFGRGRFQSWKRGRGGGNFSGKWREREHRPDLSKTTGKRTSEQTPQFLLSTK
TPQSMQSTLDRFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGS
ILVDFKELTEGGEVTNLIPDIATELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEG
LSNDGETMVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNIKPLCTKMAF
LCAACGEIQSFPLPDGKYSLPTKCPVPVCRGRSFTALRSSPLTVTMDWQSIKIQELMSDD
QREAGRIPRTIECELVHDLVDSCVPGDTVTITGIVKVSNAEEGSRNKNDKCMFLLYIEAN
SISNSKGQKTKSSEDGCKHGMLMEFSLKDLYAIQEIQAEENLFKLIVNSLCPVIFGHELV
KAGLALALFGGSQKYADDKNRIPIRGDPHILVVGDPGLGKSQMLQAACNVAPRGVYVCGN
TTTTSGLTVTLSKDSSSGDFALEAGALVLGDQGICGIDEFDKMGNQHQALLEAMEQQSIS
LAKAGVVCSLPARTSIIAAANPVGGHYNKAKTVSENLKMGSALLSRFDLVFILLDTPNEH
HDHLLSEHVIAIRAGKQRTISSATVARMNSQDSNTSVLEVVSEKPLSERLKVVPGETIDP
IPHQLLRKYIGYARQYVYPRLSTEAARVLQDFYLELRKQSQRLNSSPITTRQLESLIRLT
EARARLELREEATKEDAEDIVEIMKYSMLGTYSDEFGNLDFERSQHGSGMSNRSTAKRFI
SALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgaatggagagtatagaggcagaggatttggacgaggaagatttcaaagctggaaaagg
ggaagaggtggtgggaacttctcaggaaaatggagagaaagagaacacagacctgatctg
agtaaaaccacaggaaaacgtacttctgaacaaaccccacagtttttgctttcaacaaag
accccacagtcaatgcagtcaacattggatcgattcataccatataaaggctggaagctt
tatttctctgaagtttacagcgatagctctcctttgattgagaagattcaagcatttgaa
aaatttttcacaaggcatattgatttgtatgacaaggatgaaatagaaagaaagggaagt
attttggtagattttaaagaactgacagaaggtggtgaagtaactaacttgataccagat
atagcaactgaactaagagatgcacctgagaaaaccttggcttgcatgggtttggcaata
catcaggtgttaactaaggaccttgaaaggcatgcagctgagttacaagcccaggaagga
ttgtctaatgatggagaaacaatggtaaatgtgccacatattcatgcaagggtgtacaac
tatgagcctttgacacagctcaagaatgtcagagcaaattactatggaaaatacattgct
ctaagagggacagtggttcgtgtcagtaatataaagcctctttgcaccaagatggctttt
ctttgtgctgcatgtggagaaattcagagctttcctcttccagatggaaaatacagtctt
cccacaaagtgtcctgtgcctgtgtgtcgaggcaggtcatttactgctctccgcagctct
cctctcacagttacgatggactggcagtcaatcaaaatccaggaattgatgtctgatgat
cagagagaagcaggtcggattccacgaacaatagaatgtgagcttgttcatgatcttgtg
gatagctgtgtcccgggagacacagtgactattactggaattgtcaaagtctcaaatgcg
gaagaaggttctcgaaataagaatgacaagtgtatgttccttttgtatattgaagcaaat
tctattagtaatagcaaaggacagaaaacaaagagttctgaggatgggtgtaagcatgga
atgttgatggagttctcacttaaagacctttatgccatccaagagattcaagctgaagaa
aacctgtttaaactcattgtcaactcgctttgccctgtcatttttggtcatgaacttgtt
aaagcaggtttggcattagcactctttggaggaagccagaaatacgcagatgacaaaaac
agaattccaattcggggagacccccacatccttgttgttggagatccaggcctaggaaaa
agtcaaatgctacaggcagcgtgcaatgttgccccacgtggcgtgtatgtttgtggtaac
accacgaccacctctggtctgacggtaactctttcaaaagatagttcctctggagatttt
gctttggaagctggtgccctggtacttggtgatcaaggtatttgtggaatcgatgaattt
gataagatggggaatcaacatcaagccttgttggaagccatggagcagcaaagtattagt
cttgctaaggctggtgtggtttgtagccttcctgcaagaacttccattattgctgctgca
aatccagttggaggacattacaataaagccaaaacagtttctgagaatttaaaaatgggg
agtgcactactatccagatttgatttggtctttatcctgttagatactccaaatgagcat
catgatcacttactctctgaacatgtgattgcaataagagctggaaagcagagaaccatt
agcagtgccacagtagctcgtatgaatagtcaagattcaaatacttccgtacttgaagta
gtttctgagaagccattatcagaaagactaaaggtggttcctggagaaacaatagatccc
attccccaccagctattgagaaagtacattggctatgctcggcagtatgtgtacccaagg
ctatccacagaagctgctcgagttcttcaagatttttaccttgagctccggaaacagagc
cagaggttaaatagctcaccaatcactaccaggcagctggaatctttgattcgtctgaca
gaggcacgagcaaggttggaattgagagaggaagcaaccaaagaagacgctgaggatata
gtggaaattatgaaatatagcatgctaggaacttactctgatgaatttgggaacctagat
tttgagcgatcccagcatggttctggaatgagcaacaggtcaacagcgaaaagatttatt
tctgctctcaacaacgttgctgaaagaacttataataatatatttcaatttcatcaactt
cggcagattgccaaagaactaaacattcaggttgctgattttgaaaattttattggatca
ctaaatgaccagggttacctcttgaaaaaaggcccaaaagtttaccagcttcaaactatg
taa

DBGET integrated database retrieval system