KEGG   Homo sapiens (human): 84539Help
Entry
84539             CDS       T01001                                 

Gene name
MCHR2, GPR145, GPRv17, MCH-2R, MCH-R2, MCH2, MCH2R, MCHR-2, SLT
Definition
(RefSeq) melanin concentrating hormone receptor 2
  KO
K05054  melanin-concentrating hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84539 (MCHR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    84539 (MCHR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Melanin-concentrating hormone
    84539 (MCHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 84539
NCBI-ProteinID: NP_001035269
OMIM: 606111
HGNC: 20867
Ensembl: ENSG00000152034
Vega: OTTHUMG00000015270
Pharos: Q969V1(Tchem)
UniProt: Q969V1
Position
6q16.2
AA seq 340 aa AA seqDB search
MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttcatgcatcttgttggaacacctctgccgaacttttaaacaaatcctgg
aataaagagtttgcttatcaaactgccagtgtggtagatacagtcatcctcccttccatg
attgggattatctgttcaacagggctggttggcaacatcctcattgtattcactataata
agatccaggaaaaaaacagtccctgacatctatatctgcaacctggctgtggctgatttg
gtccacatagttggaatgccttttcttattcaccaatgggcccgagggggagagtgggtg
tttggggggcctctctgcaccatcatcacatccctggatacttgtaaccaatttgcctgt
agtgccatcatgactgtaatgagtgtggacaggtactttgccctcgtccaaccatttcga
ctgacacgttggagaacaaggtacaagaccatccggatcaatttgggcctttgggcagct
tcctttatcctggcattgcctgtctgggtctactcgaaggtcatcaaatttaaagacggt
gttgagagttgtgcttttgatttgacatcccctgacgatgtactctggtatacactttat
ttgacgataacaactttttttttccctctacccttgattttggtgtgctatattttaatt
ttatgctatacttgggagatgtatcaacagaataaggatgccagatgctgcaatcccagt
gtaccaaaacagagagtgatgaagttgacaaagatggtgctggtgctggtggtagtcttt
atcctgagtgctgccccttatcatgtgatacaactggtgaacttacagatggaacagccc
acactggccttctatgtgggttattacctctccatctgtctcagctatgccagcagcagc
attaacccttttctctacatcctgctgagtggaaatttccagaaacgtctgcctcaaatc
caaagaagagcgactgagaaggaaatcaacaatatgggaaacactctgaaatcacacttt
tag

DBGET integrated database retrieval system