KEGG   Homo sapiens (human): 8454Help
Entry
8454              CDS       T01001                                 

Gene name
CUL1
Definition
(RefSeq) cullin 1
  KO
K03347  cullin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04710  Circadian rhythm
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
Module
hsa_M00380  SCF-BTRC complex
hsa_M00381  SCF-SKP2 complex
hsa_M00382  SCF-FBS complex
hsa_M00387  SCF-FBW7 complex
Network
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8454 (CUL1)
   04120 Ubiquitin mediated proteolysis
    8454 (CUL1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8454 (CUL1)
   04340 Hedgehog signaling pathway
    8454 (CUL1)
   04350 TGF-beta signaling pathway
    8454 (CUL1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8454 (CUL1)
   04114 Oocyte meiosis
    8454 (CUL1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8454 (CUL1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8454 (CUL1)
  Infectious diseases
   05168 Herpes simplex infection
    8454 (CUL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     8454 (CUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8
Motif
Other DBs
NCBI-GeneID: 8454
NCBI-ProteinID: NP_003583
OMIM: 603134
HGNC: 2551
Ensembl: ENSG00000055130
Vega: OTTHUMG00000152776
Pharos: Q13616(Tbio)
UniProt: Q13616 A0A090N7U0 B3KTW0
Structure
PDB: 

Position
7q36.1
AA seq 776 aa AA seqDB search
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacccggagccagaacccccacggcctgaagcagattggcctggaccagatc
tgggacgacctcagagccggcatccagcaggtgtacacacggcagagcatggccaagtcc
agatatatggagctctacactcatgtttataactactgtactagtgttcaccagtcaaac
caagcacgaggagctggagttcctccttctaagtcgaaaaaggggcagacacctggagga
gctcagtttgttggcctggaattatataaacgacttaaggaatttttgaagaattacttg
acaaatcttcttaaggatggagaagatttgatggatgagagtgtactgaaattctacact
caacaatgggaagattatcgattttcaagcaaagtgctgaatggaatttgtgcctacctc
aatagacattgggttcgccgtgaatgtgacgaaggacgaaaaggaatatatgaaatctat
tcgcttgcattggtgacttggagagactgtctgttcaggccactgaataaacaggtaaca
aatgctgttttaaagctgattgaaaaggaaaggaatggtgaaaccatcaatacaagattg
attagtggagttgtacagtcttacgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccagttactgaatat
atgaaaaaggcagaggctcgtctgcttgaggaacaacgaagagttcaggtttaccttcat
gaaagcacacaagatgaattagcaaggaaatgtgaacaagtcctcattgaaaaacacttg
gaaattttccacacagaatttcagaatttattggatgctgacaaaaatgaagatttggga
cgcatgtataatcttgtatctagaatccaggatggcctaggagaattgaaaaaactgttg
gagacacacattcataatcagggtcttgcagccattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtatgtacagacagtgcttgatgttcataaaaaatacaatgccctg
gtaatgtctgcattcaacaatgacgctggctttgtggctgctcttgataaggcttgtggt
cgcttcataaacaacaacgcggttaccaagatggcccaatcatccagtaaatcccctgag
ttgctggctcgatactgtgactccttgttgaagaaaagttccaagaacccagaggaggca
gaactagaagacacactcaatcaagtgatggttgtcttcaagtacatagaagacaaagac
gtatttcagaagttctatgcgaagatgctcgccaagaggctcgtccaccagaacagtgca
agtgacgatgccgaagccagcatgatctccaagttaaagcaagcttgcgggttcgagtac
acctctaaacttcagcgcatgtttcaagacattggcgtgagcaaagatctgaacgagcaa
ttcaaaaagcacttgacaaactcagaacccctagacttggatttcagcattcaagtgctg
agctccgggtcctggcccttccagcagtcttgtacatttgccttgccgtcagagttggaa
cgtagttatcagcgattcacagctttctacgccagccgccacagtggccgaaaattgacg
tggttatatcagttgtctaaaggagaattggtaactaactgcttcaaaaacagatatact
ttgcaggcgtcgacattccagatggctatcctgcttcagtacaacacggaagatgcctac
actgtgcagcagctgaccgacagcactcaaattaaaatggacattttggcgcaagtttta
cagattttattaaagtcgaagctattggtcttggaagatgaaaatgcaaatgttgatgag
gtggaattgaagccagataccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaaccgaacagaagcaggaacaagaaaccacacac
aaaaacatcgaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaag
atgaggaaggttctgaaacaccagcagttacttggcgaggtcctcactcagctgtcctcc
aggttcaaacctcgagtccctgtgatcaagaaatgcattgacattctaattgagaaagaa
tatttggagcgagtggatggtgaaaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system