KEGG   Homo sapiens (human): 84545Help
Entry
84545             CDS       T01001                                 

Gene name
MRPL43, L43mt, MRP-L43, bMRP36a
Definition
(RefSeq) mitochondrial ribosomal protein L43
  KO
K17424  large subunit ribosomal protein L43
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    84545 (MRPL43)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    84545 (MRPL43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 84545
NCBI-ProteinID: NP_789762
OMIM: 611848
HGNC: 14517
Ensembl: ENSG00000055950
Vega: OTTHUMG00000018920
Pharos: Q8N983(Tdark)
UniProt: Q8N983
Structure
PDB: 

Position
10q24.31
AA seq 215 aa AA seqDB search
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLP
TVDPISSSLTSAPAPMLSAVSCLPIVPALTTVCSA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgcgggactccgagccgcttcttggccagcgttctccacaacggactgggt
cgctatgtgcagcagctgcagcgtctgagcttcagcgtcagccgcgacggcgcctcgtct
cgcggcgccagggagttcgtggagcgggaggtgatcgacttcgcccgacggaatccaggg
gtcgtaatatatgtaaactcgcgtccgtgctgcgtgcccagagtagtggccgaatacctt
aacggggctgtgcgcgaggagagcatccactgcaagtcggtcgaggagatctcgacgctg
gtgcagaagctggccgaccagtcgggcttggacgtgatccgcatccgcaagcccttccac
accgacaaccctagcatccagggccagtggcaccccttcaccaacaagccgaccacgttc
cgcgggctacgcccccgagaggttcaggatcctgccccagcccaggacactggcctgaga
ctgtctgcagttgcaccgcagatcctcctgcccggctggcccgacccaccagacctcccc
acagtggatcctatctcatcctcattgacctctgctccagcccctatgctgtccgcagtt
tcttgcctcccgattgtccctgcactgaccactgtgtgctcagcgtga

DBGET integrated database retrieval system