KEGG   Homo sapiens (human): 84570Help
Entry
84570             CDS       T01001                                 

Gene name
COL25A1, AMY, CFEOM5, CLAC, CLAC-P, CLACP
Definition
(RefSeq) collagen type XXV alpha 1 chain
Organism
hsa  Homo sapiens (human)
Disease
H00838  Congenital fibrosis of the extraocular muscles
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 84570
NCBI-ProteinID: NP_942014
OMIM: 610004
HGNC: 18603
Ensembl: ENSG00000188517
Vega: OTTHUMG00000150039
Pharos: Q9BXS0(Tbio)
UniProt: Q9BXS0
Position
4q25
AA seq 654 aa AA seqDB search
MLLKKHAGKGGGREPRSEDPTPAEQHCARTMPPCAVLAALLSVVAVVSCLYLGVKTNDLQ
ARIAALESAKGAPSIHLLPDTLDHLKTMVQEKVERLLAQKSYEHMAKIRIAREAPSECNC
PAGPPGKRGKRGRRGESGPPGQPGPQGPPGPKGDKGEQGDQGPRMVFPKINHGFLSADQQ
LIKRRLIKGDQGQAGPPGPPGPPGPRGPPGDTGKDGPRGMPGVPGEPGKPGEQGLMGPLG
PPGQKGSIGAPGIPGMNGQKGEPGLPGAVGQNGIPGPKGEPGEQGEKGDAGENGPKGDTG
EKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIKGEPGFIGPQGEPGLPGLPGT
KGERGEAGPPGRGERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQGPRGPPGQK
GDQGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGPKGEQGSPGIPGMDGEQGL
KGSKGDMGDPGMTGEKGGIGLPGLPGANGMKGEKGDSGMPGPQGPSIIGPPGPPGPHGPP
GPMGPHGLPGPKGTDGPMGPHGPAGPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFP
GPRGEKGDLGEKGEKGFRGVKGEKGEPGQPGLDGLDAPCQLGPDGLPMPGCWQK
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaagaagcacgcagggaaaggagggggccgggagcccagatccgaggacccg
acccctgccgaacagcattgtgcccggaccatgcccccgtgtgccgtcctggcggccctc
ctgtcagtggtggccgtggtgtcttgcctgtacctgggtgtgaaaaccaacgacctccag
gcgaggatcgccgctctcgaatccgccaaaggggccccttccattcatctgctgcctgat
accctggatcacctcaagactatggtgcaagagaaagtggagcgacttctggctcagaaa
tcctatgaacatatggctaaaataagaatcgcaagagaagcaccttcagaatgtaactgc
ccagcaggccctccagggaaacgaggtaagagaggccgaagaggagaatctggtcctcct
ggacagcctggtcctcagggccctcctggtccaaaaggcgataagggagaacaaggtgat
cagggacctaggatggtgtttcctaaaatcaatcatgggtttctctctgctgatcagcag
ctcattaaacgccgcctgattaagggtgaccaaggacaggcagggcctccaggaccccct
ggccctccaggcccaagagggccacctggggacacagggaaagatggcccccgtggaatg
ccaggagtacccggtgaaccaggaaagccaggagaacaaggcttgatgggtcctctaggg
cctccgggacaaaagggttctattggagcacctggaattccagggatgaatgggcaaaag
ggtgagcccgggttgcctggagcagtaggacagaatggaataccaggacctaagggagaa
cctggagaacaaggtgaaaagggagacgctggagagaacggccccaagggtgacacaggc
gaaaagggtgaccctggatcatctgctgcaggaattaagggagaacctggggaatctggt
cgtccagggcaaaagggtgaaccagggcttcctgggcttcctggacttccggggataaag
ggagaaccaggtttcattggtcctcaaggagaaccaggcttaccaggtttaccaggaaca
aaaggtgaacggggggaagcagggcctcctggaagaggtgagcgaggggaacctggagcc
cccggaccaaaggggaaacaaggtgaatcaggaactagaggcccaaaggggtcaaagggg
gatcgtggagaaaaaggggactctggagctcagggaccaaggggtccacctggtcaaaaa
ggggatcaaggagccactgagatcatagactacaacggcaacctccacgaagccttacag
aggattaccaccttaactgtcacgggtccccctggacctcctggacctcaaggactacaa
gggccaaagggagagcagggatctccaggaatcccaggaatggatggagagcagggactc
aaaggctcaaagggagacatgggggacccaggtatgacaggtgaaaaaggaggaattgga
cttcctggattaccgggagccaatggaatgaaaggagaaaaaggagattctggaatgccg
ggtccacagggtccttctatcataggcccaccaggcccaccaggtccccatggcccacct
ggccccatgggacctcatggacttcctggaccaaagggtacagatggtcctatgggaccc
catggccctgcaggtcccaaaggagaaagaggtgaaaaaggagctatgggagagcctgga
ccaagagggccctatgggctgcctgggaaagatggagagcctggtcttgatggcttccct
ggtccacggggtgagaagggtgatctaggagaaaagggagaaaagggattccgtggcgtt
aagggggaaaaaggggagccaggccagcctggcctggatgggctggatgccccttgccaa
ttggggccagatggcttacccatgcctggctgttggcaaaagtga

DBGET integrated database retrieval system