KEGG   Homo sapiens (human): 84570
Entry
84570             CDS       T01001                                 

Gene name
COL25A1, AMY, CFEOM5, CLAC, CLAC-P, CLACP
Definition
(RefSeq) collagen type XXV alpha 1 chain
  KO
K24356  collagen type XXV alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Disease
H00838  Congenital fibrosis of the extraocular muscles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    84570 (COL25A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    84570 (COL25A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   84570 (COL25A1)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 84570
NCBI-ProteinID: NP_942014
OMIM: 610004
HGNC: 18603
Ensembl: ENSG00000188517
Vega: OTTHUMG00000150039
Pharos: Q9BXS0(Tbio)
UniProt: Q9BXS0
Position
4q25
AA seq 654 aa
MLLKKHAGKGGGREPRSEDPTPAEQHCARTMPPCAVLAALLSVVAVVSCLYLGVKTNDLQ
ARIAALESAKGAPSIHLLPDTLDHLKTMVQEKVERLLAQKSYEHMAKIRIAREAPSECNC
PAGPPGKRGKRGRRGESGPPGQPGPQGPPGPKGDKGEQGDQGPRMVFPKINHGFLSADQQ
LIKRRLIKGDQGQAGPPGPPGPPGPRGPPGDTGKDGPRGMPGVPGEPGKPGEQGLMGPLG
PPGQKGSIGAPGIPGMNGQKGEPGLPGAVGQNGIPGPKGEPGEQGEKGDAGENGPKGDTG
EKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIKGEPGFIGPQGEPGLPGLPGT
KGERGEAGPPGRGERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQGPRGPPGQK
GDQGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGPKGEQGSPGIPGMDGEQGL
KGSKGDMGDPGMTGEKGGIGLPGLPGANGMKGEKGDSGMPGPQGPSIIGPPGPPGPHGPP
GPMGPHGLPGPKGTDGPMGPHGPAGPKGERGEKGAMGEPGPRGPYGLPGKDGEPGLDGFP
GPRGEKGDLGEKGEKGFRGVKGEKGEPGQPGLDGLDAPCQLGPDGLPMPGCWQK
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgctgctgaagaagcacgcagggaaaggagggggccgggagcccagatccgaggacccg
acccctgccgaacagcattgtgcccggaccatgcccccgtgtgccgtcctggcggccctc
ctgtcagtggtggccgtggtgtcttgcctgtacctgggtgtgaaaaccaacgacctccag
gcgaggatcgccgctctcgaatccgccaaaggggccccttccattcatctgctgcctgat
accctggatcacctcaagactatggtgcaagagaaagtggagcgacttctggctcagaaa
tcctatgaacatatggctaaaataagaatcgcaagagaagcaccttcagaatgtaactgc
ccagcaggccctccagggaaacgaggtaagagaggccgaagaggagaatctggtcctcct
ggacagcctggtcctcagggccctcctggtccaaaaggcgataagggagaacaaggtgat
cagggacctaggatggtgtttcctaaaatcaatcatgggtttctctctgctgatcagcag
ctcattaaacgccgcctgattaagggtgaccaaggacaggcagggcctccaggaccccct
ggccctccaggcccaagagggccacctggggacacagggaaagatggcccccgtggaatg
ccaggagtacccggtgaaccaggaaagccaggagaacaaggcttgatgggtcctctaggg
cctccgggacaaaagggttctattggagcacctggaattccagggatgaatgggcaaaag
ggtgagcccgggttgcctggagcagtaggacagaatggaataccaggacctaagggagaa
cctggagaacaaggtgaaaagggagacgctggagagaacggccccaagggtgacacaggc
gaaaagggtgaccctggatcatctgctgcaggaattaagggagaacctggggaatctggt
cgtccagggcaaaagggtgaaccagggcttcctgggcttcctggacttccggggataaag
ggagaaccaggtttcattggtcctcaaggagaaccaggcttaccaggtttaccaggaaca
aaaggtgaacggggggaagcagggcctcctggaagaggtgagcgaggggaacctggagcc
cccggaccaaaggggaaacaaggtgaatcaggaactagaggcccaaaggggtcaaagggg
gatcgtggagaaaaaggggactctggagctcagggaccaaggggtccacctggtcaaaaa
ggggatcaaggagccactgagatcatagactacaacggcaacctccacgaagccttacag
aggattaccaccttaactgtcacgggtccccctggacctcctggacctcaaggactacaa
gggccaaagggagagcagggatctccaggaatcccaggaatggatggagagcagggactc
aaaggctcaaagggagacatgggggacccaggtatgacaggtgaaaaaggaggaattgga
cttcctggattaccgggagccaatggaatgaaaggagaaaaaggagattctggaatgccg
ggtccacagggtccttctatcataggcccaccaggcccaccaggtccccatggcccacct
ggccccatgggacctcatggacttcctggaccaaagggtacagatggtcctatgggaccc
catggccctgcaggtcccaaaggagaaagaggtgaaaaaggagctatgggagagcctgga
ccaagagggccctatgggctgcctgggaaagatggagagcctggtcttgatggcttccct
ggtccacggggtgagaagggtgatctaggagaaaagggagaaaagggattccgtggcgtt
aagggggaaaaaggggagccaggccagcctggcctggatgggctggatgccccttgccaa
ttggggccagatggcttacccatgcctggctgttggcaaaagtga

DBGET integrated database retrieval system