KEGG   Homo sapiens (human): 8459
Entry
8459              CDS       T01001                                 

Gene name
TPST2, TANGO13B, TPST-2
Definition
(RefSeq) tyrosylprotein sulfotransferase 2
  KO
K01021  protein-tyrosine sulfotransferase [EC:2.8.2.20]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8459 (TPST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.20  protein-tyrosine sulfotransferase
     8459 (TPST2)
SSDB
Motif
Pfam: Sulfotransfer_3 Sulfotransfer_1 Sulfotransfer_4
Other DBs
NCBI-GeneID: 8459
NCBI-ProteinID: NP_001008566
OMIM: 603126
HGNC: 12021
Ensembl: ENSG00000128294
Vega: OTTHUMG00000150987
Pharos: O60704(Tbio)
UniProt: O60704 A0A024R1G9
Structure
PDB: 
3AP1 3AP2 3AP3

Position
22q12.1
AA seq 377 aa
MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHV
EYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREK
LRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLL
MVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQ
LVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSK
WTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLK
GYFQVNQNSTSSHLGSS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgcgcctgtcggtgcggagggtgctgctggcagccggctgcgccctggtcctggtgctg
gcggttcagctgggacagcaggtgctagagtgccgggcggtgctggcgggcctgcggagc
ccccggggggccatgcggcctgagcaggaggagctggtgatggtgggcaccaaccacgtg
gaataccgctatggcaaggccatgccgctcatcttcgtgggtggcgtgcctcgcagtggc
accacgttgatgcgcgccatgctggacgcgcaccccgaggtgcgctgcggcgaggagacc
cgcatcatcccgcgcgtgctggccatgcgccaggcctggtccaagtctggccgtgagaag
ctgcggctggatgaggcgggggtgacggatgaggtgctggacgccgccatgcaggccttc
atcctggaggtgattgccaagcacggagagccggcccgcgtgctctgcaacaaggaccca
tttacgctcaagtcctcggtctacctgtcgcgcctgttccccaactccaagttcctgctg
atggtgcgggacggccgggcctccgtgcactccatgatcacgcgcaaagtcaccattgcg
ggctttgacctcagcagctaccgtgactgcctcaccaagtggaacaaggccatcgaggtg
atgtacgcccagtgcatggaggtaggcaaggagaagtgcctgcctgtgtactacgagcag
ctggtgctgcaccccaggcgctcactcaagctcatcctcgacttcctcggcatcgcctgg
agcgacgctgtcctccaccatgaagacctcattggcaagcccggtggtgtctccctgtcc
aagatcgagcggtccacggaccaggtcatcaagcctgttaacctggaagcgctctccaag
tggactggccacatccctggggatgtggtgcgggacatggcccagatcgcccccatgctg
gctcagctcggctatgacccttatgcaaacccccccaactatggcaaccctgaccccttc
gtcatcaacaacacacagcgggtcttgaaaggggactataaaacaccagccaatctgaaa
ggatattttcaggtgaaccagaacagcacctcctcccacttaggaagctcgtga

DBGET integrated database retrieval system