KEGG   Homo sapiens (human): 8460Help
Entry
8460              CDS       T01001                                 

Gene name
TPST1, TANGO13A
Definition
(RefSeq) tyrosylprotein sulfotransferase 1
  KO
K01021  protein-tyrosine sulfotransferase [EC:2.8.2.20]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8460 (TPST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.20  protein-tyrosine sulfotransferase
     8460 (TPST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_3 Sulfotransfer_1 Sulfotransfer_4
Motif
Other DBs
NCBI-GeneID: 8460
NCBI-ProteinID: NP_003587
OMIM: 603125
HGNC: 12020
Ensembl: ENSG00000169902
Vega: OTTHUMG00000023871
Pharos: O60507(Tbio)
UniProt: O60507 A0A024RDK9
Structure
PDB: 

Position
7q11.21
AA seq 370 aa AA seqDB search
MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKAN
KTFAYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKE
KIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFL
LMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYE
QLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFL
KEKPQTEQVE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggttggaaagctgaagcagaacttactattggcatgtctggtgattagttctgtgact
gtgttttacctgggccagcatgccatggaatgccatcaccggatagaggaacgtagccag
ccagtcaaattggagagcacaaggaccactgtgagaactggcctggacctcaaagccaac
aaaacctttgcctatcacaaagatatgcctttaatatttattggaggtgtgcctcggagt
ggaaccacactcatgagggccatgctggacgcacatcctgacattcgctgtggagaggaa
accagggtcattccccgaatcctggccctgaagcagatgtggtcacggtcaagtaaagag
aagatccgcctggatgaggctggtgttactgatgaagtgctggattctgccatgcaagcc
ttcttactagaaattatcgttaagcatggggagccagccccttatttatgtaataaagat
ccttttgccctgaaatctttaacttacctttctaggttattccccaatgccaaatttctc
ctgatggtccgagatggccgggcatcagtacattcaatgatttctcgaaaagttactata
gctggatttgatctgaacagctatagggactgtttgacaaagtggaatcgtgctatagag
accatgtataaccagtgtatggaggttggttataaaaagtgcatgttggttcactatgaa
caacttgtcttacatcctgaacggtggatgagaacactcttaaagttcctccagattcca
tggaaccactcagtattgcaccatgaagagatgattgggaaagctgggggagtgtctctg
tcaaaagtggagagatctacagaccaagtaatcaagccagtcaatgtaggagctctatca
aaatgggttgggaagataccgccagatgttttacaagacatggcagtgattgctcctatg
cttgccaagcttggatatgacccatatgccaacccacctaactacggaaaacctgatccc
aaaattattgaaaacactcgaagggtctataagggagaattccaactacctgactttctt
aaagaaaaaccacagactgagcaagtggagtag

DBGET integrated database retrieval system