KEGG   Homo sapiens (human): 84626
Entry
84626             CDS       T01001                                 
Symbol
KRBA1
Name
(RefSeq) KRAB-A domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: KRBA1
Other DBs
NCBI-GeneID: 84626
NCBI-ProteinID: NP_115923
HGNC: 22228
Ensembl: ENSG00000133619
Pharos: A5PL33(Tdark)
UniProt: A5PL33
Position
7:149714951..149734575
AA seq 1030 aa
MRENYETLVSVGTAELLPLSAFLSPSEPGRAVGGGSHADEGQEPAGCGDPQGGQPRHSLH
LTALVQLVKEIPEFLFGEVKGAMDSPESESRGASLDGERASPEAAAAREPCPLRGLLSCL
PDGPTSQPHLATTPTDSSCSSGPTGDGVQGSPLPIKTADKPWPTRKEGPGALGGEPSPPT
HSPSRRKSHRGQERGTSEAGISPGNSPLQGLINCLKEILVPGPRHPETSPSFLPPLPSLG
TSRLTRADLGPGSPPWAVKTEAVSGDCPLQGLLHCLKELPEAQDRHPSPSGVGNRRLQEN
PGAWKRGSGGPGYLLTPPPHPDLGAGGLLSVKMENSWVQSPPGPASCQPGRQPLSPSATG
DTRGVPQPSWGPEAQAASASSSPLEALEACLKGIPPNGSSPSQLPPTSCSQNPQPGDSRS
QKPELQPHRSHSEEATREPVLPLGLQSCVRDGPSRPLAPRGTPTSFSSSSSTDWDLDFGS
PVGNQGQHPGKGSPPGSSPLQGLENCLKEIPVPVLRPAWPCSSAADRGPRRAEPRNWTAD
KEGLRAEACESARLGQGRGEAPTRSLHLVSPQVFTSSCVPACHQRGFKDPGATRPGVWRW
LPEGSAPKPSPLHCLESALRGILPVRPLRFACVGGPSPSPSPGSSSSFSGSEGEDPRPEP
DLWKPLPQERDRLPSCKPPVPLSPCPGGTPAGSSGGSPGEDPRRTEPRYCSGLGAGTAQD
PCPVSQLEKRPRVSEASRGLELGHGRPRVAAKTHERLLPQGPPELPSESPPPELPPPEAA
PPVLPASSLQPPCHCGKPLQQELHSLGAALAEKLDRLATALAGLAQEVATMRTQVNRLGR
RPQGPGPMGQASWMWTLPRGPRWAHGPGHRHLPYWRQKGPTRPKPKILRGQGESCRAGDL
QGLSRGTARRARPLPPDAPPAEPPGLHCSSSQQLLSSTPSCHAAPPAHPLLAHTGGHQSP
LPPLVPAALPLQGASPPAASADADVPTSGVAPDGIPERPKEPSSLLGGVQRALQEELWGG
EHRDPRWGAH
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgcgggagaactacgagacgctggtctctgtggggacagctgagctgctccccctctct
gctttcctgtcaccctcagagcctggaagagctgttgggggagggagccacgctgatgag
gggcaggagcctgctggttgtggagatccccaggggggacagccccggcacagcctgcac
ctcacagccctggtgcagctggtgaaggagatcccagagttcttgtttggagaagtcaag
ggcgctatggacagccccgagagcgagagccggggagccagcctggatggagagagagcg
agccccgaggcagctgcggcaagagagccctgccctctccgaggcctgctcagctgcctt
ccagacggccctaccagccagccccacctggccaccacgcccaccgacagctcgtgttcc
agtggcccaactggtgacggggtccagggaagtcctctccccatcaaaactgccgacaaa
ccgtggcctacaaggaaggaaggcccaggagccctgggcggggagcccagccctcccacc
catagccccagcaggaggaagagccacagaggacaggagagagggacctcagaggccgga
atttctcctgggaacagccccttgcaaggcctcatcaactgtctgaaggaaatccttgtg
cctgggccccggcaccccgagacatccccaagcttcttgccacctctccctagcctgggc
acgtccaggctaaccagagcagacctggggcctgggagcccgccctgggcagtgaagacc
gaggcggtttcaggggattgtcccctccagggtctgctacactgtctgaaggagctcccc
gaggcccaggacaggcatcccagtccctcaggagtggggaaccgacggctacaggagaat
ccaggagcctggaaaaggggttctggagggcctggatacctcctgacccctcctccccat
cctgatcttggagctggcggtctgctctctgtgaagatggagaacagctgggtccagagc
cccccaggacctgcatcctgtcagcctggcaggcagcccctcagtccctcagccactgga
gacaccagaggggtcccccaacccagctggggccctgaggctcaagctgccagtgcctca
agctcaccgctggaagccctggaagcctgtctgaagggcattcccccaaatgggtcgtca
ccttcccagctgccacccacttcttgttcccagaacccccagccaggagactctaggtct
cagaagcctgaactgcaaccccacagatcacacagtgaagaagcgaccagagagcctgtt
ctgcctctgggtctgcagagctgtgtgagagatggccccagcaggcccctggccccccga
ggaacccccaccagcttctcctcatccagcagcaccgactgggacctggattttgggagt
cctgtggggaaccaggggcagcatcctggaaaaggaagcccaccaggaagctccccactg
cagggtctggagaattgtctcaaggagatacctgtgcctgtgctgcggcctgcctggccc
tgctcctcagcagcagacaggggaccgaggagagcagagcccaggaactggacagcagac
aaggaaggactgagggctgaggcctgcgagtcagcccgtctcgggcagggtaggggagaa
gcgcccacccggagcctccatctggtcagcccacaggtgttcacctccagctgcgtcccc
gcctgccaccagcgggggttcaaagaccctggggccaccaggccaggagtgtggaggtgg
ctcccagaggggtctgcccccaagccctccccgctgcactgcctggagagcgccctgagg
gggatcttgcctgtaaggcccttgcgcttcgcctgcgtgggaggccccagccccagcccc
agccccggctccagctcgagcttcagcggctctgaaggagaagacccgaggccagagcct
gatctctggaagccgctcccccaggagagggaccgccttcccagctgtaagcctcctgtc
cctctgtccccatgtcctggtgggacccctgctggcagcagtggcggcagccctggtgaa
gaccccaggagaacagagcccaggtactgcagcggcctcggtgcaggtacagctcaggat
ccctgcccggtttctcagctggagaaaaggcccagggttagtgaagcatccagaggcctg
gagcttggacatggaagacccagagttgcagccaagacccatgagaggctgctcccccag
ggcccgcctgagctgcccagtgagtctccccctccggagctgccccctccggaagctgcg
cctcctgtgttgccagcctcctccctgcagccgccatgccactgtgggaagcccctgcag
caggagctgcacagcctcggtgctgcccttgcggagaagctggatcggctcgccacagcg
ctggcaggcctggctcaggaagtggccaccatgaggacccaggtgaatcggctggggagg
cgcccccaaggccctgggccaatgggccaagcttcctggatgtggaccctcccacgggga
cctcgctgggctcatggccctggtcacagacatctgccctactggaggcagaagggaccc
acgaggcctaaaccaaagatcctgcgtggccagggagagagctgcagggctggtgacctg
caaggactctccagagggaccgctcgccgggcacgtccgctgcctccagacgctcccccg
gcagaacctcctgggctccactgcagctcttcccagcagctgctgtcctctacacccagc
tgccatgctgcgccgcctgcacaccccctcctcgcacataccgggggccaccagagcccc
cttccccctttagtgcctgctgccttacccctgcagggagcctctcctcctgcagccagt
gcagatgcagacgtgccgacctcaggagtggcaccagacgggatcccagagcggcccaag
gagccgagcagcctgctgggaggagtgcagagggccctccaggaagaactgtggggtggg
gagcacagggacccgagatggggggcgcattga

DBGET integrated database retrieval system