KEGG   Homo sapiens (human): 84628
Entry
84628             CDS       T01001                                 

Symbol
NTNG2, LHLL9381, Lmnt2, NEDBASH, NTNG1, bA479K20.1
Name
(RefSeq) netrin G2
  KO
K16359  netrin-G2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules
Disease
H02459  Syndromic neurodevelopmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    84628 (NTNG2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    84628 (NTNG2)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF EGF_2
Other DBs
NCBI-GeneID: 84628
NCBI-ProteinID: NP_115925
OMIM: 618689
HGNC: 14288
Ensembl: ENSG00000196358
Vega: OTTHUMG00000020835
Pharos: Q96CW9(Tbio)
UniProt: Q96CW9
Structure
PDB: 
3TBD 3ZYG 3ZYI

Position
9q34.13
AA seq 530 aa
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACATAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRG
YTGVRCEQPRCDPADDDGGLDCDRAPGAAPRPATLLGCLLLLGLAARLGR
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgctgcatctgctggcgctcttcctgcactgcctccctctggcctctggggactatgac
atctgcaaatcctgggtgaccacagatgagggccccacctgggagttctacgcctgccag
cccaaggtgatgcgcctgaaggactacgtcaaggtgaaggtggagccctcaggcatcaca
tgtggagacccccctgagaggttctgctcccatgagaatccctacctatgcagcaacgag
tgtgacgcctccaacccggacctggcccacccgcccaggctcatgttcgacaaggaggag
gagggcctggccacctactggcagagcatcacctggagccgctaccccagcccgctggaa
gccaacatcaccctttcgtggaacaagaccgtggagctgaccgacgacgtggtgatgacc
ttcgagtacggccggcccacggtcatggtcctggagaagtccctggacaacgggcgcacc
tggcagccctaccagttctacgccgaggactgcatggaggccttcggtatgtccgcccgc
cgggcccgcgacatgtcatcctccagcgcgcaccgcgtgctctgcaccgaggagtactcg
cgctgggcaggctccaagaaggagaagcacgtgcgcttcgaggtgcgggaccgcttcgcc
atctttgccggccccgacctgcgcaacatggacaacctctacacgcggctggagagcgcc
aagggcctcaaggagttcttcaccctcaccgacctgcgcatgcggctgctgcgcccggcg
ctgggcggcacctatgtgcagcgggagaacctctacaagtacttctacgccatctccaac
atcgaggtcatcggcaggtgcaagtgcaacctgcacgccaacctgtgctccatgcgcgag
ggcagcctgcagtgcgagtgcgagcacaacaccaccggccccgactgcggcaagtgcaag
aagaatttccgcacccggtcctggcgggccggctcctacctgccgctgccccatggctct
cccaacgcctgtgccactgcaggttcctttggcaactgcgaatgctacggtcactccaac
cgctgcagctacattgacttcctgaatgtggtgacctgcgtcagctgcaagcacaacacg
cgaggtcagcactgccagcactgccggctgggctactaccgcaacggctcggcagagctg
gatgatgagaacgtctgcattgagtgtaactgcaaccagataggctccgtgcacgaccgg
tgcaacgagaccggcttctgcgagtgccgcgagggcgcggcgggccccaagtgcgacgac
tgcctccccacgcactactggcgccagggctgctaccccaacgtgtgcgacgacgaccag
ctgctgtgccagaacggaggcacctgcctgcagaaccagcgctgcgcctgcccgcgcggc
tacaccggcgtgcgctgcgagcagccccgctgcgaccccgccgacgatgacggcggtctg
gactgcgaccgcgcgcccggggccgccccgcgccccgccaccctgctcggctgcctgctg
ctgctggggctggccgcccgcctgggccgctga

DBGET integrated database retrieval system