KEGG   Homo sapiens (human): 84629
Entry
84629             CDS       T01001                                 
Symbol
TNRC18, CAGL79, TNRC18A
Name
(RefSeq) trinucleotide repeat containing 18
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BAHCC1-like_Tudor BAH Tudor_3 DUF4537
Other DBs
NCBI-GeneID: 84629
NCBI-ProteinID: NP_001073964
HGNC: 11962
Ensembl: ENSG00000182095
UniProt: O15417 A3KMH2
Structure
Position
7:complement(5306811..5423834)
AA seq 2968 aa
MDGRDFGPQRSVHGPPPPLLSGLAMDSHRVGAATAGRLPASGLPGPLPPGKYMAGLNLHP
HPGEAFLGSFVASGMGPSASSHGSPVPLPSDLSFRSPTPSNLPMVQLWAAHAHEGFSHLP
SGLYPSYLHLNHLEPPSSGSPLLSQLGQPSIFDTQKGQGPGGDGFYLPTAGAPGSLHSHA
PSARTPGGGHSSGAPAKGSSSRDGPAKERAGRGGEPPPLFGKKDPRARGEEASGPRGVVD
LTQEARAEGRQDRGPPRLAERLSPFLAESKTKNAALQPSVLTMCNGGAGDVGLPALVAEA
GRGGAKEAARQDEGARLLRRTETLLPGPRPCPSPLPPPPAPPKGPPAPPAATPAGVYTVF
REQGREHRVVAPTFVPSVEAFDERPGPIQIASQARDARAREREAGRPGVLQAPPGSPRPL
DRPEGLREKNSVIRSLKRPPPADAPTVRATRASPDPRAYVPAKELLKPEADPRPCERAPR
GPAGPAAQQAAKLFGLEPGRPPPTGPEHKWKPFELGNFAATQMAVLAAQHHHSRAEEEAA
VVAASSSKKAYLDPGAVLPRSAATCGRPVADMHSAAHGSGEASAMQSLIKYSGSFARDAV
AVRPGGCGKKSPFGGLGTMKPEPAPTSAGASRAQARLPHSGGPAAGGGRQLKRDPERPES
AKAFGREGSGAQGEAEVRHPPVGIAVAVARQKDSGGSGRLGPGLVDQERSLSLSNVKGHG
RADEDCVDDRARHREERLLGARLDRDQEKLLRESKELADLARLHPTSCAPNGLNPNLMVT
GGPALAGSGRWSADPAAHLATHPWLPRSGNASMWLAGHPYGLGPPSLHQGMAPAFPPGLG
GSLPSAYQFVRDPQSGQLVVIPSDHLPHFAELMERATVPPLWPALYPPGRSPLHHAQQLQ
LFSQQHFLRQQEFLYLQQQAAQALELQRSAQLVQERLKAQEHRAEMEEKGSKRGLEAAGK
AGLATAGPGLLPRKPPGLAAGPAGTYGKAVSPPPSPRASPVAALKAKVIQKLEDVSKPPA
YAYPATPSSHPTSPPPASPPPTPGITRKEEAPENVVEKKDLELEKEAPSPFQALFSDIPP
RYPFQALPPHYGRPYPFLLQPTAAADADGLAPDVPLPADGPERLALSPEDKPIRLSPSKI
TEPLREGPEEEPLAEREVKAEVEDMDEGPTELPPLESPLPLPAAEAMATPSPAGGCGGGL
LEAQALSATGQSCAEPSECPDFVEGPEPRVDSPGRTEPCTAALDLGVQLTPETLVEAKEE
PVEVPVAVPVVEAVPEEGLAQVAPSESQPTLEMSDCDVPAGEGQCPSLEPQEAVPVLGST
CFLEEASSDQFLPSLEDPLAGMNALAAAAELPQARPLPSPGAAGAQALEKLEAAESLVLE
QSFLHGITLLSEIAELELERRSQEMGGAERALVARPSLESLLAAGSHMLREVLDGPVVDP
LKNLRLPRELKPNKKYSWMRKKEERMYAMKSSLEDMDALELDFRMRLAEVQRQYKEKQRE
LVKLQRRRDSEDRREEPHRSLARRGPGRPRKRTHAPSALSPPRKRGKSGHSSGKLSSKSL
LTSDDYELGAGIRKRHKGSEEEHDALIGMGKARGRNQTWDEHEASSDFISQLKIKKKKMA
SDQEQLASKLDKALSLTKQDKLKSPFKFSDSAGGKSKTSGGCGRYLTPYDSLLGKNRKAL
AKGLGLSLKSSREGKHKRAAKTRKMEVGFKARGQPKSAHSPFASEVSSYSYNTDSEEDEE
FLKDEWPAQGPSSSKLTPSLLCSMVAKNSKAAGGPKLTKRGLAAPRTLKPKPATSRKQPF
CLLLREAEARSSFSDSSEESFDQDESSEEEDEEEELEEEDEASGGGYRLGARERALSPGL
EESGLGLLARFAASALPSPTVGPSLSVVQLEAKQKARKKEERQSLLGTEFEYTDSESEVK
VRKRSPAGLLRPKKGLGEPGPSLAAPTPGARGPDPSSPDKAKLAVEKGRKARKLRGPKEP
GFEAGPEASDDDLWTRRRSERIFLHDASAAAPAPVSTAPATKTSRCAKGGPLSPRKDAGR
AKDRKDPRKKKKGKEAGPGAGLPPPRAPALPSEARAPHASSLTAAKRSKAKAKGKEVKKE
NRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVERPLTPAPRSCIIDKDELK
DGLRVLIPMDDKLLYAGHVQTVHSPDIYRVVVEGERGNRPHIYCLEQLLQEAIIDVRPAS
TRFLPQGTRIAAYWSQQYRCLYPGTVVRGLLDLEDDGDLITVEFDDGDTGRIPLSHIRLL
PPDYKIQCAEPSPALLVPSAKRRSRKTSKDTGEGKDGGTAGSEEPGAKARGRGRKPSAKA
KGDRAATLEEGNPTDEVPSTPLALEPSSTPGSKKSPPEPVDKRAKAPKARPAPPQPSPAP
PAFTSCPAPEPFAELPAPATSLAPAPLITMPATRPKPKKARAAEESGAKGPRRPGEEAEL
LVKLDHEGVTSPKSKKAKEALLLREDPGAGGWQEPKSLLSLGSYPPAAGSSEPKAPWPKA
TDGDLAQEPGPGLTFEDSGNPKSPDKAQAEQDGAEESESSSSSSSGSSSSSSSSSSSGSE
TEGEEEGDKNGDGGCGTGGRNCSAASSRAASPASSSSSSSSSSSSSSSSSSSSSSSSSSS
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTDEDSSCSSDDEAAPAPTAGPSAQAALP
TKATKQAGKARPSAHSPGKKTPAPQPQAPPPQPTQPLQPKAQAGAKSRPKKREGVHLPTT
KELAKRQRLPSVENRPKIAAFLPARQLWKWFGKPTQRRGMKGKARKLFYKAIVRGKEMIR
IGDCAVFLSAGRPNLPYIGRIQSMWESWGNNMVVRVKWFYHPEETSPGKQFHQGQHWDQK
SSRSLPAALRVSSQRKDFMERALYQSSHVDENDVQTVSHKCLVVGLEQYEQMLKTKKYQD
SEGLYYLAGTYEPTTGMIFSTDGVPVLC
NT seq 8907 nt   +upstreamnt  +downstreamnt
atggatggccgagacttcgggccccagcggtccgtgcacggtcccccgccgccgctgctg
tccggcctggccatggacagccaccgcgtgggcgcggccactgccggacgcttgcccgcc
tcgggcttgcccggcccgctgccgcccgggaagtacatggccggcctgaatctccatccg
cacccgggcgaggccttcttgggcagctttgtggccagcgggatggggccctcggcctcg
tcccatgggagcccagtgccactgccctctgacctgtctttccgctccccaacccctagc
aacctgcccatggtgcagctgtgggccgcccacgcccatgaaggcttctcccacctgccc
agtgggctgtacccatcctacctccacctgaaccacctggagccccccagcagtgggagc
cccctcctcagccagctgggtcagcccagcattttcgatacccagaaaggtcaggggcca
ggaggagacggtttctacctgcccaccgcgggggctccgggctccctgcactctcacgcg
ccctcggcccggacccctggcggcggccactcctcgggcgccccggccaaaggctcgtcg
tcgcgggacggtccagccaaggagcgggcgggccgcggcggggagccgcctccgcttttc
ggcaagaaggacccgcgcgcccggggcgaggaggcctcggggccacggggcgtggtggac
ctgacccaggaggcgcgcgccgagggccgccaggaccgggggcccccgcgcctggctgag
cgcctgtcgcccttcctggctgagtccaagaccaagaatgcggcgctgcagccgtcggta
ctgaccatgtgcaacggcggcgccggggacgtggggctgcccgcgctggtggccgaagcg
gggcgcgggggtgccaaggaggctgcccggcaggacgagggcgcgcggctgctgcggcgc
acggagaccctgctccctgggccgcgcccctgcccctcaccgctgcccccgccgcccgcg
ccccccaaggggcctcctgcaccccccgcggccacccccgccggcgtctacaccgtcttc
cgcgagcagggccgtgagcaccgcgtggtggcgcccaccttcgtgccttccgtggaggcc
ttcgacgagcgcccggggcccatccagatcgcatcccaggcgcgcgatgcccgggcccgc
gagcgcgaggctggcaggccaggggtcctgcaggcgccccccggctccccgcggcctctg
gaccggcccgagggcctgcgcgagaagaactcggtcatccgctcgctcaagcggccgccc
cccgcggatgcccccacggtgcgggccacacgcgcctccccggacccccgcgcctacgtg
cctgccaaggagctgctcaagcccgaggcggacccgaggccctgcgagcgtgcgccccgc
ggcccagccggtcctgcagcccaacaggccgccaagctcttcggcctggagcccgggcgc
cccccgcccaccggccctgagcataaatggaaacccttcgagctgggcaacttcgccgcc
acgcagatggccgtgctggccgcgcagcaccaccacagccgcgccgaagaggaggccgcc
gtggtcgctgcctcctcctccaagaaggcctacctggaccctggggctgtgctgccccgc
tcggcggccacctgcggccggccggtcgctgacatgcactctgcggcccacgggtctgga
gaggcctcggccatgcagagccttataaagtacagtggcagctttgcccgggacgccgtg
gccgtgcgccctggtggctgtggcaagaagagcccctttggaggtttgggcaccatgaaa
cccgagcctgcgcccacctctgcgggtgcctcccgagcccaggcccgtctcccacactcc
ggaggccctgcagcgggcggcggccggcagctgaagcgggaccccgagaggcccgagagc
gccaaagctttcgggcgcgagggctctggtgcccagggtgaggcagaagtgcgacacccg
cctgtgggcattgcagtggctgtggcccggcagaaggacagtggcggcagtggccggctg
gggcctgggctggtagaccaggagcgctctctgtcgctgagtaacgtcaaagggcacggc
cgagcagatgaggactgtgtggacgaccgggccagacaccgggaggaacggctgctcggg
gcacggctggaccgggatcaggagaagctgctcagagagagtaaggagctggctgacctg
gcccgcctgcaccctaccagctgtgctcctaacggcctgaaccccaacctcatggtgacg
gggggcccggcgctggcgggctcaggtcgctggtctgccgaccccgcagcccatctggcc
acgcacccctggttgccccgctcgggcaacgcatccatgtggctcgctggacacccctac
ggcttgggtcccccatctctgcaccagggcatggcccctgcgttcccacctggcctgggg
ggctccctcccgtcagcctaccagtttgtcagggacccccaatcgggccagctggtggtc
attcccagtgatcaccttcctcactttgcggagctgatggagcgggccaccgtaccgccc
ctctggcccgccctgtacccgccgggccgcagccccctgcaccacgcccagcagctgcag
ctcttctcacagcagcacttcctgcggcagcaggagttcctgtacctgcagcagcaggcg
gcccaggccttggaactgcagaggagcgcccagctcgtgcaggagcggttgaaggcgcag
gagcaccgggcggagatggaagagaaggggagcaagcggggcctggaggctgcgggcaag
gctggcctggccaccgccggccccgggctgctgccgcggaagccccctggcctggccgcc
ggccccgcgggcacctacggcaaggccgtgagcccgccaccatcaccccgcgcatcccct
gtggctgccctgaaggccaaggtcatccagaagctggaggacgtgtccaagccacccgcc
tacgcctaccccgccacccccagctcccaccccaccagcccgccgcccgcctccccaccg
cccaccccgggtatcacccgcaaggaggaggctcccgagaatgtggtcgagaagaaagac
ttggagttggagaaggaagcccccagccccttccaggccctgttctcagatatcccgccc
aggtacccgttccaagccctgccaccgcactacgggaggccctaccctttcctgctgcag
cccacggccgccgccgacgcggacggcttggcccctgatgtgccgctcccggctgatggg
cccgagcgcctggcactctcacccgaagacaagcccatccgcttgtccccctccaagatc
acagagccgctgcgggagggcccggaggaagaaccgctggctgagcgggaggtgaaggca
gaggtggaggacatggacgagggccccacagagctgccgcctctggagtcgccgctgcca
ctgcccgccgcggaagccatggctacccccagccctgcagggggttgtggaggtggcctg
ttggaggcccaggcgctgagtgccaccgggcagagctgcgcagagccctctgagtgtcca
gactttgtggaggggcctgaaccacgggtggattccccgggccggacagaaccctgcacc
gccgccctggacctgggggtgcagctgacacccgagacactggtggaggccaaggaggag
ccggtggaggtgcctgtggcggtgcccgtggtggaggcagtgcccgaggaaggcctggcg
caggtggcaccgagcgagtcccagcccaccctagaaatgtcagactgtgacgtgcccgcc
ggggagggacagtgcccgagcctggagccccaagaggccgtgcctgtactcggcagcacc
tgcttcctggaagaggcaagctctgaccagttcctgcccagtctggaggacccactggct
ggcatgaacgccctggcggcagctgcggagctgccccaggccaggcctctgccctccccg
ggtgctgctggagcccaggccttggagaagctggaagcagccgagagccttgtcttggag
cagagcttcctgcatggcatcaccctgctaagtgagatcgcagagctggagctggagagg
aggagccaagagatgggaggtgcggagcgggccctggtggcgcggccctccctggagagt
ctgctggcagctggcagccacatgctgagggaggtgctggatgggcccgtggtggaccca
ctcaagaacctgcggctcccgcgggagctgaagcccaacaagaagtacagctggatgcgc
aagaaggaggagcggatgtatgccatgaagtcctccctggaggacatggacgccctggag
ctggacttccggatgcggctggccgaggtgcagcgccagtacaaggagaagcagcgtgag
ctggtgaagctgcagcgccgccgggactccgaggacaggcgcgaggaaccccatagaagc
ttggcacgcagaggccctggcaggccgcggaaacggacccacgccccgagcgccctgtcg
cccccccgcaagagagggaagagcggccacagtagcggaaagctgagcagcaagtctctg
ctgacatcagatgattatgagctgggagcagggataagaaagagacacaaggggtctgag
gaggaacatgatgccctcatcggaatggggaaagccagggggaggaaccagacttgggat
gaacatgaggcctcgtcggacttcatcagtcagctaaagattaagaagaagaagatggcc
agcgaccaggagcagttggcaagcaagctcgacaaggccctctccctcaccaagcaggac
aagttgaagtcgcccttcaagttttcggacagtgctggggggaaatcgaaaactagcggg
ggctgcggcaggtacttgactccttacgacagcctgctggggaagaacaggaaggcgctg
gccaagggcctcggcctgtctctgaaatcctccagagaaggtaaacacaaaagggcagcc
aaaaccaggaagatggaggtggggttcaaggccagaggccagcccaagtcggcccattcc
ccgtttgcctcggaagtgagcagctactcttacaatacggactcagaggaagacgaagaa
ttcctgaaggacgagtggcccgcccaaggcccctccagctccaaactgacgccttccctc
ctgtgtagcatggtggcaaagaacagcaaggcagctggtggccccaagctgaccaagagg
ggcctggcggccccccggactctgaaacccaagccggccaccagcaggaagcagccgttt
tgtctgctgcttcgagaggccgaggcgcgttcctccttcagcgactcttcggaggaatcg
tttgaccaagatgagagctcggaggaggaggacgaggaggaggagctcgaggaggaggac
gaggccagcggtggtggctacaggctgggtgcccgggagcgggccctgtcaccgggcctg
gaggagagtgggctgggcctgctggcacgcttcgccgccagcgccctccccagccccacg
gtgggtccatccctgtctgtggtacagctggaggccaagcagaaggcccggaagaaagag
gagcggcagagcctgctgggcacagagttcgagtacaccgactcagagagcgaggtcaag
gtgcgcaagcggtcgcctgcggggctgctgcggcccaagaaggggctgggggagccggga
ccctccctggccgcacccacgcctggcgcccgcggtcccgaccccagcagcccagacaag
gccaagctggcggtggagaaggggcgcaaggcccggaagctgcggggccccaaggagcct
ggcttcgaggcggggcccgaggccagcgacgacgacctgtggacgcggcgccgcagcgag
cgcatcttcctgcacgacgcctcggctgctgcacctgcgcccgtcagcaccgcgcccgcc
accaagaccagccgctgcgccaagggcggccccctgagcccgcgcaaggacgccgggcgt
gcaaaggacaggaaggaccccaggaagaagaagaaagggaaagaggctgggccaggagct
gggctgccgccgccccgagctcctgccttgccctctgaggccagggctcctcacgccagc
tccctgaccgctgccaaaaggagcaaagccaaggccaaagggaaggaggtgaagaaggag
aaccgcggcaaggggggtgccgtgagcaagctgatggagagcatggcagccgaggaggac
tttgaacccaaccaagactcgagcttctctgaggacgagcacctgccgcgtggcggggct
gtggagcggccgctgaccccggcccctcgctcctgcatcatcgacaaggatgagctgaag
gacggcctgcgtgtgctcatccccatggatgacaagctgctgtacgccgggcacgtgcag
accgtgcactcgccagacatataccgcgtggtggtggagggtgagcggggcaaccggccc
cacatctactgtctggagcagttgctgcaggaggcgatcatcgatgtgaggccagcctcc
actcgcttcttgccacaagggaccaggattgcagcctactggagccagcagtaccgctgt
ctctacccaggcactgtggtccgagggttactggacctggaggacgatggggacttgatc
accgtggagtttgacgacggagacacgggcaggatccccctctcacatatccgcctcctg
ccccctgactataagatacagtgtgctgagccgtccccggcccttctggtgccaagtgcc
aagcgccgcagccggaagaccagcaaagacactggggagggcaaagatggtggcacggct
gggtcggaggagccaggagccaaggcccgtgggcgtgggcggaaacccagcgccaaggcc
aagggtgacagagccgctaccctggaggaggggaacccaacagacgaggtccccagtacc
cccttagccctggagccgagcagcaccccaggttccaagaagagccccccagagcctgtg
gacaagcgagccaaggcccccaaggcgcgcccggcaccgccgcagcccagtcccgcacca
cccgccttcaccagctgcccagcacccgagccatttgcagagctgccagctcctgccacc
tccctggccccagcacccctcatcaccatgcctgccacacgccccaagcccaagaaggcg
cgggcagccgaggagtcgggtgccaagggccctcggaggccgggggaggaggccgagctg
cttgtcaaactggaccacgagggtgtcacgtcacccaaaagcaagaaggctaaagaggcc
ctgctgctccgggaggatccgggggcggggggctggcaggagcccaagagcctcctgagc
ctgggcagctatccccccgcggccggcagcagcgagcccaaggcaccctggcccaaggcc
accgacggggacctcgcccaggagcccgggccggggctcacgttcgaggactctgggaac
cccaagagcccagacaaggcccaggctgagcaggacggggccgaagagtccgagagcagc
agcagcagcagtagtggcagcagtagcagcagcagcagcagcagcagcagcggctcggag
acagaaggggaggaggaaggcgacaagaacggggacgggggctgcggcaccgggggccgt
aactgcagcgctgccagctccagggcggcctcaccggcctcctcctcctcctcctcatcc
tcctcctcctcctcctcctcctcctcatcctcctcttcctcctcctcctcttcctcctcc
tcctcttcctcttcgtcttcctcctcttcctcctcctcctcttcctcgtcctcatcctcc
tcctcctcctcctcttcctcctcttcttcctccaccacagacgaggactcttcctgcagc
tcggacgatgaggcagcccccgcccccacggctggcccttccgcgcaggcggcgctcccc
accaaggccaccaagcaggccggcaaggcgcggccctcggcccactccccaggcaagaag
acgcccgcgccccagccccaggcgcctcctccgcagcccacacagcctctgcagcccaag
gctcaggccggggccaagagccgacccaagaagagagagggcgtccacctccccaccacc
aaggagctggccaagcggcagcgcctgccgtccgtggagaaccggcccaagatcgccgcc
ttcctgccagcccggcagctctggaagtggttcggcaagcccacccagcggcgtggcatg
aagggcaaggcccgcaagctcttctacaaggccatcgtgcgcggcaaggagatgatccgt
atcggggactgtgccgtgttcctctctgccggccgccccaacctgccctacatcggccgc
atccagagcatgtgggagtcgtggggcaacaacatggtggtccgcgtcaagtggttctac
caccccgaggagaccagcccgggcaagcagttccaccagggccagcactgggaccagaag
tccagccgcagcctcccggcggccctgcgggtctccagccagaggaaggacttcatggag
cgcgcgctataccagtcctcgcatgtggacgaaaatgacgtgcagacggtgtcgcacaag
tgcctggtggtgggcctggagcagtatgagcagatgctgaagaccaagaagtaccaggac
agcgagggcctgtactacctcgcgggcacctacgagcccaccacgggcatgatcttctcc
acggacggcgtgcccgtgctctgctga

DBGET integrated database retrieval system