KEGG   Homo sapiens (human): 8463
Entry
8463              CDS       T01001                                 

Gene name
TEAD2, ETF, TEAD-2, TEF-4, TEF4
Definition
(RefSeq) TEA domain transcription factor 2
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    8463 (TEAD2)
   04392 Hippo signaling pathway - multiple species
    8463 (TEAD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8463 (TEAD2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    8463 (TEAD2)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 8463
NCBI-ProteinID: NP_003589
OMIM: 601729
HGNC: 11715
Ensembl: ENSG00000074219
Vega: OTTHUMG00000183174
Pharos: Q15562(Tbio)
UniProt: Q15562
Structure
PDB: 

Position
19q13.33
AA seq 447 aa
MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK
DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPF
SQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPP
DAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVET
ERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL
LLCTAYVFEVSTSERGAQHHIYRLVRD
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggggaaccccgggctggggccgccctggacgatggcagcggctggacgggcagtgag
gaaggcagtgaggagggtaccggcggcagtgagggggctgggggtgacgggggcccggat
gcagagggggtgtggagcccagacattgagcagagcttccaggaggccctggccatctat
ccaccctgcggccgccggaaaataattttgtctgatgaaggcaagatgtatggtcggaat
gaactgatcgcccgctacatcaagctgagaacggggaagacccgaactcgaaaacaggtt
tctagtcacatccaggttttggcccgaaggaaatcaagggaaatccagtccaagttgaag
gaccaggtttccaaggacaaggctttccagacaatggcaaccatgtcctctgcccagctc
atctccgcgccttctctgcaggccaaactgggtcccactggtcctcaggcctctgagctt
ttccagttttggtctggaggatctgggcccccctggaatgttccagatgtgaagccattc
tcacagacaccgttcaccttgtcactgactcccccatctactgacctcccagggtacgag
cccccccaagccctctcacccctgcccccacctaccccatcgcccccagcctggcaggct
cggggcctgggcaccgcccggttgcagctggtagagttctcagccttcgtggaaccgcca
gatgcagttgattcttaccagaggcacctgttcgtgcacatcagccagcactgccccagc
cccggagcgccgccgctcgagagtgtggacgtccggcagatctacgacaaattccctgag
aaaaagggtggcctccgagagctatatgatcgtggccccccccatgccttcttcctggtc
aagttctgggcggacctgaactggggcccaagtggtgaggaggcaggggccggtggcagc
atcagcagtggtggcttctacggagtgagcagccagtatgagagcctggaacacatgacc
ctcacctgttcctccaaggtctgctcttttggcaagcaggtggtggagaaggtggagacg
gaacgggcccagctggaggacggcagatttgtgtaccgcctgctgcgctcgcccatgtgc
gagtacctggtgaatttcttgcacaagttgcggcagctgcctgagcgatacatgatgaac
agcgtcctggaaaacttcaccatcctccaggtggtgacaaacagagacacccaggaactg
ctgctctgcaccgcctatgtcttcgaggtctccaccagcgagcgtggggcccagcatcac
atttaccgcctggtcagggactga

DBGET integrated database retrieval system