KEGG   Homo sapiens (human): 84631Help
Entry
84631             CDS       T01001                                 

Gene name
SLITRK2, CXorf1, CXorf2, SLITL1, TMEM257
Definition
(RefSeq) SLIT and NTRK like family member 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT
Motif
Other DBs
NCBI-GeneID: 84631
NCBI-ProteinID: NP_001137475
OMIM: 300561
HGNC: 13449
Ensembl: ENSG00000185985
Vega: OTTHUMG00000022595
Pharos: Q9H156(Tbio)
UniProt: Q9H156
Position
Xq27.3
AA seq 845 aa AA seqDB search
MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNN
KLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
VLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
IVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPK
ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQ
ERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFT
NLTSLRRLYLNGNYLEVLYPSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNN
NLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGL
KDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPR
SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNL
DVSSFQLQYGSYNTETHDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSY
SNLEEKKEEPATPAYTISATELLEKQATPREPELLYQNIAERVKELPSAGLVHYNFCTLP
KRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAKPQSEPDYLEVLEKQT
AISQL
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcggcgtttggttcctcagtgtgttaaccgtggccgggatcttacagacagag
agtcgcaaaactgccaaagacatttgcaagatccgctgtctgtgcgaagaaaaggaaaac
gtactgaatatcaactgtgagaacaaaggatttacaacagttagcctgctccagcccccc
cagtatcgaatctatcagctttttctcaatggaaacctcttgacaagactgtatccaaac
gaatttgtcaattactccaacgcggtgactcttcacctaggtaacaacgggttacaggag
atccgaacgggggcattcagtggcctgaaaactctcaaaagactgcatctcaacaacaac
aagcttgagatattgagggaggacaccttcctaggcctggagagcctggagtatctccag
gccgactacaattacatcagtgccatcgaggctggggcattcagcaaacttaacaagctc
aaagtgctcatcctgaatgacaaccttctgctttcactgcccagcaatgtgttccgcttt
gtcctgctgacccacttagacctcagggggaataggctaaaagtaatgccttttgctggc
gtccttgaacatattggagggatcatggagattcagctggaggaaaatccatggaattgc
acttgtgacttacttcctctcaaggcctggctagacaccataactgtttttgtgggagag
attgtctgtgagactccctttaggttgcatgggaaagacgtgacccagctgaccaggcaa
gacctctgtcccagaaaaagtgccagtgattccagtcagaggggcagccatgctgacacc
cacgtccaaaggctgtcacctacaatgaatcctgctctcaacccaaccagggctccgaaa
gccagccggccgcccaaaatgagaaatcgtccaactcctcgagtgactgtgtcaaaggac
aggcaaagttttggacccatcatggtgtaccagaccaagtctcctgtgcctctcacctgt
cccagcagctgtgtctgcacctctcagagctcagacaatggtctgaatgtaaactgccaa
gaaaggaagttcactaatatctctgacctgcagcccaaaccgaccagtccaaagaaactc
tacctaacagggaactatcttcaaactgtctataagaatgacctcttagaatacagttct
ttggacttactgcacttaggaaacaacaggattgcagtcattcaggaaggtgcctttaca
aacctgaccagtttacgcagactttatctgaatggcaattaccttgaagtgctgtaccct
tctatgtttgatggactgcagagcttgcaatatctctatttagagtataatgtcattaag
gaaattaagcctctgacctttgatgctttgattaacctacagctactgtttctgaacaac
aaccttcttcggtccttacctgataatatatttggggggacggccctaaccaggctgaat
ctgagaaacaaccatttttctcacctgcccgtgaaaggggttctggatcagctcccggct
ttcatccagatagatctgcaggagaacccctgggactgtacctgtgacatcatggggctg
aaagactggacagaacatgccaattcccctgtcatcattaatgaggtgacttgcgaatct
cctgctaagcatgcaggggagatactaaaatttctggggagggaggctatctgtccagac
agcccaaacttgtcagatggaaccgtcttgtcaatgaatcacaatacagacacacctcgg
tcgcttagtgtgtctcctagttcctatcctgaactacacactgaagttccactgtctgtc
ttaattctgggattgcttgttgttttcatcttatctgtctgttttggggctggtttattc
gtctttgtcttgaaacgccgaaagggagtgccgagcgttcccaggaataccaacaactta
gacgtaagctcctttcaattacagtatgggtcttacaacactgagactcacgataaaaca
gacggccatgtctacaactatatccccccacctgtgggtcagatgtgccaaaaccccatc
tacatgcagaaggaaggagacccagtagcctattaccgaaacctgcaagagttcagctat
agcaacctggaggagaaaaaagaagagccagccacacctgcttacacaataagtgccact
gagctgctagaaaagcaggccacaccaagagagcctgagctgctgtatcaaaatattgct
gagcgagtcaaggaacttcccagcgcaggcctagtccactataacttttgtaccttacct
aaaaggcagtttgccccttcctatgaatctcgacgccaaaaccaagacagaatcaataaa
accgttttatatggaactcccaggaaatgctttgtggggcagtcaaaacccaaccaccct
ttactgcaagctaagccgcaatcagaaccggactacctcgaagttctggaaaaacaaact
gcaatcagtcagctgtga

DBGET integrated database retrieval system