KEGG   Homo sapiens (human): 84632
Entry
84632             CDS       T01001                                 

Gene name
AFAP1L2, CTB-1144G6.4, KIAA1914, XB130
Definition
(RefSeq) actin filament associated protein 1 like 2
  KO
K23782   
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PH PH_11 CENP-Q Mod_r DUF3450 Spc7 Tex_N THOC7 TMPIT
Other DBs
NCBI-GeneID: 84632
NCBI-ProteinID: NP_001001936
OMIM: 612420
HGNC: 25901
Ensembl: ENSG00000169129
Vega: OTTHUMG00000019086
Pharos: Q8N4X5(Tbio)
UniProt: Q8N4X5
Structure
PDB: 
2COF

Position
10q25.3
AA seq 818 aa
MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKV
TINKQQNAESQGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESP
EGYYEEAEPYDTSLNEDGEAVSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICA
FLWRKKWLGQWAKQLCVIKDNRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLK
ITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEGNQYTPDAQRFNCQKPDIAEK
YLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPVERSLETSSYL
NVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQ
RKFSEPNTYIDGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDL
TPVKSFLHGPSSAQAQASSPTLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLES
LEPEDPSLRITTVKIQTEQQRISFPPSCPDAVVATPPGASPPVKDRLRVTSAEIKLGKNR
TEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETLLKCTDKEVLASLEQKLKEID
EECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENVSPRPKAVTPASAPD
CTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagcggtacaaagccctggaacagctgctgacagagttggatgacttcctcaagatt
cttgaccaggagaacctgagcagcacagcactggtgaagaagagctgcctggcggagctc
ctccggctttacaccaaaagcagcagctctgatgaggagtacatttatatgaacaaagtg
accatcaacaagcaacagaatgcagagtctcaaggcaaagcgcctgaggagcagggcctg
ctacccaatggggagcccagccagcactcctcggcccctcagaagagccttccagacctc
ccgccacccaagatgattccagaacggaaacagcttgccatcccaaagacggagtctcca
gagggctactatgaagaggctgagccatatgacacatccctcaatgaggacggagaggct
gtgagcagctcctacgagtcctacgatgaagaggacggcagcaagggcaagtcggcccct
taccagtggccctcgccggaggccggcatcgagctgatgcgtgacgcccgcatctgcgcc
ttcctgtggcgcaagaagtggctgggacagtgggccaagcagctctgtgtcatcaaggac
aacaggcttctgtgctacaaatcctccaaggaccacagccctcagctggacgtgaaccta
ctgggcagcagcgtcattcacaaggagaagcaagtgcggaagaaggagcacaagctgaag
atcacgccgatgaatgccgatgtgattgtgctgggcctgcagagcaaggaccaggctgag
cagtggctcagggtcatccaggaagtgagcggcctgccttccgaaggagcatctgaagga
aaccagtacaccccggatgcccagcgctttaactgccagaaaccagatatagctgagaag
tacctgtcggcttcagagtatgggagctccgtggatggccaccctgaggtcccagaaacc
aaagacgtcaagaagaaatgttctgctggcctcaaactgagcaacctaatgaatctgggc
aggaagaaatccacctcactggagcctgtggagaggtccctcgagacatccagttacctg
aacgtgctggtgaacagccagtggaagtctcgctggtgctctgtcagggacaatcacctg
cacttctaccaggaccggaaccggagcaaggtggcccagcaacccctcagcctggtgggc
tgcgaggtggtcccagaccccagccccgaccacctctactccttccgcatcctccacaag
ggcgaggagctggccaagcttgaggccaagtcttccgaggaaatgggccactggctgggt
ctcctgctctctgagtcaggctccaagacagacccagaagagttcacctacgactatgtg
gatgccgatagggtctcctgtattgtgagtgcggccaaaaactctctcttactgatgcag
agaaagttctcagagcccaacacttacatcgatggcctgcctagccaggaccgccaggag
gagctgtatgacgacgtggacctgtcagagctcacagctgcggtggagcctaccgaggaa
gccacccctgttgcagatgacccaaatgagagagaatctgaccgagtgtacctggacctc
acacctgtcaagtcctttctgcatggccccagcagtgcacaggcccaggcctcctccccg
acgttgtcctgcctggacaatgcaactgaggccctcccggcagactcaggcccaggtccc
accccagatgagccctgcataaagtgtccagagaacctgggagaacagcagctggagagt
ttggagccagaggatccttccctgagaatcaccaccgtcaaaatccagacggaacagcag
agaatctccttcccaccgagctgcccggatgccgtggtggccaccccacctggtgccagc
ccacctgtgaaggacaggttgcgcgtgaccagtgcagagatcaagcttggcaagaatcgg
acagaagctgaggtgaagcggtacacagaggagaaggagaggcttgaaaagaagaaggaa
gaaatccgggggcacctggctcagctccggaaagagaaacgggagctaaaggaaacccta
ctgaaatgcacagacaaggaagtcctggcgagcctggagcagaagctgaaggaaattgac
gaggagtgccggggcgaggagagcaggcgcgtggacctggagctcagcatcatggaggtg
aaggacaacctgaagaaggctgaggcagggcctgtgacgttaggcaccaccgtggacacc
acccacctggagaatgtgagcccccgccccaaagctgtcacacctgcctctgccccagac
tgtaccccagtcaactctgcaaccacactcaagaacaggcctctctcggtcgtggtcaca
ggcaaaggcactgtactccagaaagccaaggaatgggagaagaaaggagcaagttag

DBGET integrated database retrieval system