KEGG   Homo sapiens (human): 84634Help
Entry
84634             CDS       T01001                                 

Gene name
KISS1R, AXOR12, CPPB1, GPR54, HH8, HOT7T175, KISS-1R
Definition
(RefSeq) KISS1 receptor
  KO
K08374  KISS1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04929  GnRH secretion
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00869  KISS1-KISS1R-PLCB-PKC signaling pathway
N00870  Mutation-inactivated KISS1 to KISS1-KISS1R-PLCB-PKC signaling pathway
N00871  Mutation-inactivated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
N00872  Mutation-activated KISS1R to KISS1-KISS1R-PLCB-PKC signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
H00937  Precocious puberty
H02018  Central precocious puberty
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84634 (KISS1R)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    84634 (KISS1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    84634 (KISS1R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Galanin
    84634 (KISS1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 84634
NCBI-ProteinID: NP_115940
OMIM: 604161
HGNC: 4510
Ensembl: ENSG00000116014
Vega: OTTHUMG00000181900
Pharos: Q969F8(Tchem)
UniProt: Q969F8
Position
19p13.3
AA seq 398 aa AA seqDB search
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN
SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL
HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP
ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA
AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH
AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgtggctacgtccggacccaacgcgtcctggggggcaccggccaacgcctcc
ggctgcccgggctgtggcgccaacgcctcggacggcccagtcccttcgccgcgggccgtg
gacgcctggctcgtgccgctcttcttcgcggcgctgatgctgctgggcctggtggggaac
tcgctggtcatctacgtcatctgccgccacaagccgatgcggaccgtgaccaacttctac
atcgccaacctggcggccacggacgtgaccttcctcctgtgctgcgtccccttcacggcc
ctgctgtacccgctgcccggctgggtgctgggcgacttcatgtgcaagttcgtcaactac
atccagcaggtctcggtgcaggccacgtgtgccactctgaccgccatgagtgtggaccgc
tggtacgtgacggtgttcccgttgcgcgccctgcaccgccgcacgccccgcctggcgctg
gctgtcagcctcagcatctgggtaggctctgcggcggtgtctgcgccggtgctcgccctg
caccgcctgtcacccgggccgcgcgcctactgcagtgaggccttccccagccgcgccctg
gagcgcgccttcgcactgtacaacctgctggcgctgtacctgctgccgctgctcgccacc
tgcgcctgctatgcggccatgctgcgccacctgggccgggtcgccgtgcgccccgcgccc
gccgatagcgccctgcaggggcaggtgctggcagagcgcgcaggcgccgtgcgggccaag
gtctcgcggctggtggcggccgtggtcctgctcttcgccgcctgctggggccccatccag
ctgttcctggtgctgcaggcgctgggccccgcgggctcctggcacccacgcagctacgcc
gcctacgcgcttaagacctgggctcactgcatgtcctacagcaactccgcgctgaacccg
ctgctctacgccttcctgggctcgcacttccgacaggccttccgccgcgtctgcccctgc
gcgccgcgccgcccccgccgcccccgccggcccggaccctcggaccccgcagccccacac
gcggagctgctccgcctggggtcccacccggcccccgccagggcgcagaagccagggagc
agtgggctggccgcgcgcgggctgtgcgtcctgggggaggacaacgcccctctctga

DBGET integrated database retrieval system