KEGG   Homo sapiens (human): 8464Help
Entry
8464              CDS       T01001                                 

Gene name
SUPT3H, SPT3, SPT3L
Definition
(RefSeq) SPT3 homolog, SAGA and STAGA complex component
  KO
K11313  transcription initiation protein SPT3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    8464 (SUPT3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8464 (SUPT3H)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8464 (SUPT3H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8464 (SUPT3H)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     8464 (SUPT3H)
    STAGA complex
     8464 (SUPT3H)
    TFTC complex
     8464 (SUPT3H)
    SAGA complex
     8464 (SUPT3H)
    SLIK complex
     8464 (SUPT3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 8464
NCBI-ProteinID: NP_001248752
OMIM: 602947
HGNC: 11466
Ensembl: ENSG00000196284
Vega: OTTHUMG00000014773
Pharos: O75486(Tbio)
UniProt: B4E1H0
Position
6p21.1
AA seq 165 aa AA seqDB search
MFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIK
PNVVAMEILAYLAYETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAAC
GVEAHSDAIQPCHIREAIRRYSHRIGPLSPFTNAYRRNGMAFLAC
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagatgacgaaattgatgaagttaaacaagaaagaatggagagagcagaaaga
caaactcgaattatggattcagctcaatatgcagaattctgtgaaagtcgacaattaagt
ttctccaaaaaagcttccaaatttcgagactggttggactgcagcagtatggagataaaa
cccaatgttgtcgcaatggaaatcttagcatatttagcgtatgaaactgtggcacagtta
gtggatctggctcttcttgtgaggcaagacatggtaaccaaggcaggggaccccttcagc
catgccatttctgcaaccttcattcagtatcacaactctgctgagagcactgcagcctgt
ggtgttgaggctcacagcgatgccatccagccctgccacatcagagaggccattcgacgc
tacagccacaggattggcccactttccccattcacaaatgcctaccgcaggaatgggatg
gcttttctagcctgctga

DBGET integrated database retrieval system