KEGG   Homo sapiens (human): 84649
Entry
84649             CDS       T01001                                 

Gene name
DGAT2, ARAT, GS1999FULL, HMFN1045
Definition
(RefSeq) diacylglycerol O-acyltransferase 2
  KO
K11160  diacylglycerol O-acyltransferase 2 [EC:2.3.1.20 2.3.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    84649 (DGAT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    84649 (DGAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     84649 (DGAT2)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     84649 (DGAT2)
SSDB
Motif
Pfam: DAGAT Acyltransferase
Other DBs
NCBI-GeneID: 84649
NCBI-ProteinID: NP_115953
OMIM: 606983
HGNC: 16940
Ensembl: ENSG00000062282
Vega: OTTHUMG00000165338
Pharos: Q96PD7(Tbio)
UniProt: Q96PD7
Position
11q13.5
AA seq 388 aa
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaagaccctcatagccgcctactccggggtcctgcgcggcgagcgtcaggccgaggct
gaccggagccagcgctctcacggaggacctgcgctgtcgcgcgaggggtctgggagatgg
ggcactggatccagcatcctctccgccctccaggacctcttctctgtcacctggctcaat
aggtccaaggtggaaaagcagctacaggtcatctcagtgctccagtgggtcctgtccttc
cttgtactgggagtggcctgcagtgccatcctcatgtacatattctgcactgattgctgg
ctcatcgctgtgctctacttcacttggctggtgtttgactggaacacacccaagaaaggt
ggcaggaggtcacagtgggtccgaaactgggctgtgtggcgctactttcgagactacttt
cccatccagctggtgaagacacacaacctgctgaccaccaggaactatatctttggatac
cacccccatggtatcatgggcctgggtgccttctgcaacttcagcacagaggccacagaa
gtgagcaagaagttcccaggcatacggccttacctggctacactggcaggcaacttccga
atgcctgtgttgagggagtacctgatgtctggaggtatctgccctgtcagccgggacacc
atagactatttgctttcaaagaatgggagtggcaatgctatcatcatcgtggtcgggggt
gcggctgagtctctgagctccatgcctggcaagaatgcagtcaccctgcggaaccgcaag
ggctttgtgaaactggccctgcgtcatggagctgacctggttcccatctactcctttgga
gagaatgaagtgtacaagcaggtgatcttcgaggagggctcctggggccgatgggtccag
aagaagttccagaaatacattggtttcgccccatgcatcttccatggtcgaggcctcttc
tcctccgacacctgggggctggtgccctactccaagcccatcaccactgttgtgggagag
cccatcaccatccccaagctggagcacccaacccagcaagacatcgacctgtaccacacc
atgtacatggaggccctggtgaagctcttcgacaagcacaagaccaagttcggcctcccg
gagactgaggtcctggaggtgaactga

KEGG   Homo sapiens (human): 8694
Entry
8694              CDS       T01001                                 

Gene name
DGAT1, ARAT, ARGP1, DGAT, DIAR7
Definition
(RefSeq) diacylglycerol O-acyltransferase 1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Module
hsa_M00089  Triacylglycerol biosynthesis
Disease
H01174  Congenital diarrhea
Drug target
Pradigastat (DG01846): D10657 D10664
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8694 (DGAT1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8694 (DGAT1)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    8694 (DGAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     8694 (DGAT1)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     8694 (DGAT1)
    2.3.1.76  retinol O-fatty-acyltransferase
     8694 (DGAT1)
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 8694
NCBI-ProteinID: NP_036211
OMIM: 604900
HGNC: 2843
Ensembl: ENSG00000185000
Vega: OTTHUMG00000174606
Pharos: O75907(Tclin)
UniProt: O75907
Position
8q24.3
AA seq 488 aa
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgggcgaccgcggcagctcccggcgccggaggacagggtcgcggccctcgagccacggc
ggcggcgggcctgcggcggcggaagaggaggtgcgggacgccgctgcgggccccgacgtg
ggagccgcgggggacgcgccagccccggcccccaacaaggacggagacgccggcgtgggc
agcggccactgggagctgaggtgccatcgcctgcaggattctttattcagctctgacagt
ggcttcagcaactaccgtggcatcctgaactggtgtgtggtgatgctgatcttgagcaat
gcccggttatttctggagaacctcatcaagtatggcatcctggtggaccccatccaggtg
gtttctctgttcctgaaggatccctatagctggcccgccccatgcctggttattgcggcc
aatgtctttgctgtggctgcattccaggttgagaagcgcctggcggtgggtgccctgacg
gagcaggcgggactgctgctgcacgtggccaacctggccaccattctgtgtttcccagcg
gctgtggtcttactggttgagtctatcactccagtgggctccctgctggcgctgatggcg
cacaccatcctcttcctcaagctcttctcctaccgcgacgtcaactcatggtgccgcagg
gccagggccaaggctgcctctgcagggaagaaggccagcagtgctgctgccccgcacacc
gtgagctacccggacaatctgacctaccgcgatctctactacttcctcttcgcccccacc
ttgtgctacgagctcaactttccccgctctccccgcatccggaagcgctttctgctgcga
cggatccttgagatgctgttcttcacccagctccaggtggggctgatccagcagtggatg
gtccccaccatccagaactccatgaagcccttcaaggacatggactactcacgcatcatc
gagcgcctcctgaagctggcggtccccaatcacctcatctggctcatcttcttctactgg
ctcttccactcctgcctgaatgccgtggctgagctcatgcagtttggagaccgggagttc
taccgggactggtggaactccgagtctgtcacctacttctggcagaactggaacatccct
gtgcacaagtggtgcatcagacacttctacaagcccatgcttcgacggggcagcagcaag
tggatggccaggacaggggtgttcctggcctcggccttcttccacgagtacctggtgagc
gtccctctgcgaatgttccgcctctgggcgttcacgggcatgatggctcagatcccactg
gcctggttcgtgggccgctttttccagggcaactatggcaacgcagctgtgtggctgtcg
ctcatcatcggacagccaatagccgtcctcatgtacgtccacgactactacgtgctcaac
tatgaggccccagcggcagaggcctga

DBGET integrated database retrieval system