KEGG   Homo sapiens (human): 84658
Entry
84658             CDS       T01001                                 

Gene name
ADGRE3, EMR3
Definition
(RefSeq) adhesion G protein-coupled receptor E3
  KO
K08444  adhesion G protein-coupled receptor E3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84658 (ADGRE3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    84658 (ADGRE3)
Peptidases and inhibitors [BR:hsa01002]
 Mixed peptidases
  Family P2
   84658 (ADGRE3)
G protein-coupled receptors [BR:hsa04030]
 Adhesion receptor family
  EGF-like module-containing mucin-like hormone receptor-like (EMR)
   84658 (ADGRE3)
SSDB
Motif
Pfam: 7tm_2 GPS cEGF GAIN EGF_CA EGF_3 EGF_MSP1_1 FXa_inhibition
Other DBs
NCBI-GeneID: 84658
NCBI-ProteinID: NP_115960
OMIM: 606101
HGNC: 23647
Ensembl: ENSG00000131355
Vega: OTTHUMG00000183406
Pharos: Q9BY15(Tbio)
UniProt: Q9BY15 B7Z5A1 Q0IJ53 A1L1B9
Position
19p13.12
AA seq 652 aa
MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTF
PLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDT
TSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDP
EQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFI
SYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTK
KVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVIT
YVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS
IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVA
ISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSE
VSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCL
LSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgcagggaccattgcttcttccaggcctctgctttctgctgagcctctttggagctgtg
actcagaaaaccaaaacttcctgtgctaagtgccccccaaatgcttcctgtgtcaataac
actcactgcacctgcaaccatggatatacttctggatctgggcagaaactattcacattc
cccttggagacatgtaacgacattaatgaatgtacaccaccctatagtgtatattgtgga
tttaacgctgtgtgttacaatgtcgaaggaagtttctactgtcaatgtgtcccaggatat
agactgcattctgggaatgaacaattcagtaattccaatgagaacacctgtcaggacacc
acctcctcaaagacaaccgagggcaggaaagagctgcaaaagattgtggacaaatttgag
tcacttctcaccaatcagactttatggagaacagaagggagacaagaaatctcatccaca
gctaccactattctccgggatgtggaatcgaaagttctagaaactgccttgaaagatcca
gaacaaaaagtcctgaaaatccaaaacgatagtgtagctattgaaactcaagcgattaca
gacaattgctctgaagaaagaaagacattcaacttgaacgtccaaatgaactcaatggac
atccgttgcagtgacatcatccagggagacacacaaggtcccagtgccattgcctttatc
tcatattcttctcttggaaacatcataaatgcaactttttttgaagagatggataagaaa
gatcaagtgtatctgaactctcaggttgtgagtgctgctattggacccaaaaggaacgtg
tctctctccaagtctgtgacgctgactttccagcacgtgaagatgacccccagtaccaaa
aaggtcttctgtgtctactggaagagcacagggcagggcagccagtggtccagggatggc
tgcttcctgatacacgtgaacaagagtcacaccatgtgtaattgcagtcacctgtccagc
ttcgctgtcctgatggccctgaccagccaggaggaggatcccgtgctgactgtcatcacc
tacgtggggctgagcgtctctctgctgtgcctcctcctggcggccctcacttttctcctg
tgtaaagccatccggaacaccagcacctcactgcatctgcagctctcgctctgcctcttc
ctggcccacctcctcttcctcgtggggattgatcgaactgaacccaaggtgctgtgctcc
atcatcgccggtgctttgcactatctctacctggccgccttcacctggatgctgctggag
ggtgtgcacctcttcctcactgcacggaacctgacagtggtcaactactcaagcatcaat
agactcatgaagtggatcatgttcccagtcggctatggcgttcccgctgtgactgtggcc
atttctgcagcctcctggcctcacctttatggaactgctgatcgatgctggctccacctg
gaccagggattcatgtggagtttccttggcccagtctgtgccattttctctgcgaattta
gtattgtttatcttggtcttttggattttgaaaagaaaactttcctccctcaatagtgaa
gtgtcaaccatccagaacacaaggatgctggctttcaaagcaacagctcagctcttcatc
ctgggctgcacatggtgtctgggcttgctacaggtgggtccagctgcccaggtcatggcc
tacctcttcaccatcatcaacagcctccaaggcttcttcatcttcttggtctactgcctc
ctcagccagcaggtccagaaacaatatcaaaagtggtttagagagatcgtaaaatcaaaa
tctgagtctgagacatacacactttccagcaagatgggtcctgactcaaaacccagtgag
ggggatgtttttccaggacaagtgaagagaaaatattaa

DBGET integrated database retrieval system