KEGG   Homo sapiens (human): 84662Help
Entry
84662             CDS       T01001                                 

Gene name
GLIS2, NKL, NPHP7
Definition
(RefSeq) GLIS family zinc finger 2
  KO
K09233  zinc finger protein GLIS2
Organism
hsa  Homo sapiens (human)
Disease
H00537  Nephronophthisis
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    84662 (GLIS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_6 zf-C2H2_4 FOXP-CC zf-met
Motif
Other DBs
NCBI-GeneID: 84662
NCBI-ProteinID: NP_001305847
OMIM: 608539
HGNC: 29450
Ensembl: ENSG00000126603
Vega: OTTHUMG00000129467
Pharos: Q9BZE0(Tbio)
UniProt: Q9BZE0 B3KTH4
Position
16p13.3
AA seq 524 aa AA seqDB search
MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFL
LNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPL
RYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFE
LLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTC
SKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGC
HKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAA
LFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSP
FGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGL
PLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcactccctggacgagccgctcgacctgaagctgagtatcaccaagctccgggcggca
agagagaagcgggagaggacgctgggtgtggtccggccccgtgctctgcacagggagctg
ggcctggtggatgacagccccacacctggctctccaggctccccgccctcaggcttcctg
ctgaactccaagttccccgagaaggtggagggacgcttttcagcagcccctctcgtggac
ctcagcctgtcaccaccatctgggctggactcccccaatggcagcagctcgctgtccccc
gagcgccagggcaacggggacctgcctccagtgcccagtgcctcggacttccagccactg
cgctatttggatggtgtccccagctccttccagttcttcctgcccctcggctccgggggg
gccctgcacctgcctgcctcctccttccttacccctcccaaggacaagtgcctctcgcca
gacctgcccctgcccaagcagctggtgtgtcgctgggccaagtgtaaccagctctttgag
ctcctgcaagacctggtggaccatgtcaacgattaccatgtcaagcccgagaaggatgcg
gggtactgctgccactgggagggctgcgcccgccatggccgaggtttcaacgccaggtac
aagatgctcatccacatccgcacacacaccaacgagaagccacaccgctgtccgacctgc
agcaagagcttctcccgcctggagaacctgaagatccacaaccggtcgcacacaggtgag
aagccctacgtctgcccctacgagggctgcaacaagcgctattccaactccagtgaccgc
tttaagcacacgcgcacccactatgtggacaagccctactactgcaagatgcccggctgc
cacaagcgctacacggaccccagctcactgcgcaagcacatcaaggcccatggccacttt
gtgtcccacgagcagcaagagctcctgcagctgcgcccaccccccaagccgccactgccc
gcccccgacggcggcccctatgtcagtggggcccagatcatcatccccaacccagctgcc
ctctttggaggccctggcctgcccggcttacccctacccctggcccccggcccccttgac
ctcagtgccctggcctgtggcaacggtgggggcagtgggggtggggggggcatgggccct
gggctgccaggccccgtcctgcctctcaatctggccaagaacccgctgctgccctcgccc
tttggggctggcggactgggcttgcctgtggtctccctccttgctggcgcagctggtggc
aaggccgagggggagaaggggcgtgggtcggtgcccaccagggccctgggcatggagggc
cacaagacgccccttgaaaggacggagagcagctgctcccggccaagccccgatggactc
cccctgctgccaggcaccgtgctggacctgtccacgggcgtcaactcagctgccagcagc
ccagaggcgttggcccctggctgggtggtcatcccgccgggctcggtgctgctcaaaccg
gctgtggtgaactga

DBGET integrated database retrieval system