KEGG   Homo sapiens (human): 84667Help
Entry
84667             CDS       T01001                                 

Gene name
HES7, SCDO4, bHLHb37
Definition
(RefSeq) hes family bHLH transcription factor 7
  KO
K09087  hairy and enhancer of split 2/6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Disease
H00517  Spondylocostal dysostosis (SCD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    84667 (HES7)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    84667 (HES7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 84667
NCBI-ProteinID: NP_115969
OMIM: 608059
HGNC: 15977
Ensembl: ENSG00000179111
Vega: OTTHUMG00000178316
Pharos: Q9BYE0(Tbio)
UniProt: Q9BYE0
Position
17p13.1
AA seq 225 aa AA seqDB search
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccgggatcgagctgagaatagggacggccccaagatgctcaagccgcttgtg
gagaagcggcgccgggaccgcatcaaccgcagcctggaagagctgaggctgctgctgctg
gagcggacccgggaccagaacctccggaacccgaagctggagaaagcggagatattggag
ttcgccgtgggctacttgagggagcgaagccgggtggagcccccgggggttccccggtcc
ccagtccaggacgccgaggcgctcgccagctgctacttgtccggtttccgcgagtgcctg
cttcgcttggcggccttcgcgcacgacgccagcccggccgcccgcgcccagctcttctcc
gcgctgcacggctatctgcgccccaaaccgccccggcccaagccggtagatccgaggcct
ccagcgccgcgcccatccctggaccccgccgcaccggcccttggccctgcgctgcaccag
cgccccccagtgcaccagggccaccctagcccgcgctgcgcatggtccccatccctctgc
tccccgcgcgccggggattctggcgcgccggcgcccctcaccggactgctgccgccgcca
ccgccgcctcacagacaagacggggcgcccaaggccccgctgcccccgccgcccgctttc
tggagaccttggccctga

DBGET integrated database retrieval system