KEGG   Homo sapiens (human): 8467Help
Entry
8467              CDS       T01001                                 

Gene name
SMARCA5, ISWI, SNF2H, WCRF135, hISWI, hSNF2H
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
  KO
K11654  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8467 (SMARCA5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8467 (SMARCA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     8467 (SMARCA5)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    NoRC (nucleolar remodeling complex)
     8467 (SMARCA5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   CHRAC complex
    8467 (SMARCA5)
   RSF complex
    8467 (SMARCA5)
   WICH complex
    8467 (SMARCA5)
   B-WICH complex
    8467 (SMARCA5)
   NuRF complex (fruit fly)
    8467 (SMARCA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF2_N SLIDE HAND Helicase_C ResIII DEAD HDA2-3 DBINO Myb_DNA-binding ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 8467
NCBI-ProteinID: NP_003592
OMIM: 603375
HGNC: 11101
Ensembl: ENSG00000153147
Vega: OTTHUMG00000161474
Pharos: O60264(Tbio)
UniProt: O60264
Position
4q31.21
AA seq 1052 aa AA seqDB search
MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEE
IFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKM
KPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKL
RDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKST
LHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKF
NWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFN
SADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVT
NSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQD
SINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTK
TVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATH
VFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYR
EKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPR
LFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKI
MAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLH
KLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEK
AEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgcggccgagcctccgccacccccgcctcccgagagcgcgccttccaagccc
gcagcctcgatcgccagcggcgggagcaacagcagcaacaaaggcggccccgaaggcgtc
gcggcgcaggcggttgcgtctgcggccagcgctggtcccgcagacgccgagatggaggaa
atatttgatgatgcgtcacctggaaagcaaaaggaaatccaagaaccagatcctacctat
gaagaaaaaatgcaaactgaccgggcaaatagattcgagtatttattaaagcagacagaa
ctttttgcacatttcattcaacctgctgctcagaagactccaacttcacctttgaagatg
aaaccagggcgcccacgaataaaaaaagatgagaagcagaacttactatccgttggcgat
taccgacaccgtagaacagagcaagaggaggatgaagagctattaacagaaagctccaaa
gcaaccaatgtttgcactcgatttgaagactctccatcgtatgtaaaatggggtaaactg
agagattatcaggtccgaggattaaactggctcatttctttgtatgagaatggcatcaat
ggtatccttgcagatgaaatgggcctaggaaagactcttcaaacaatttctcttcttggg
tacatgaaacattatagaaacattcctgggcctcatatggttttggttcctaagtctaca
ttacacaactggatgagtgaattcaagagatgggtaccaacacttagatctgtttgtttg
ataggagataaagaacaaagagctgcttttgtcagagacgttttattaccgggagaatgg
gatgtatgtgtaacatcttatgaaatgcttattaaagagaagtctgtgttcaaaaaattt
aattggagatacttagtaatagatgaagctcacaggatcaaaaatgaaaaatctaagttg
tcagaaatagtgagggaattcaagactacaaatagactattattaactggaacacctctt
cagaacaacttgcatgagctgtggtcacttcttaactttctgttgccagatgtgtttaat
tcagcagatgactttgattcctggtttgatacaaacaactgccttggggatcaaaaacta
gttgagaggcttcatatggttttgcgtccattcctccttcgtcgaattaaggctgatgtt
gaaaagagtttgcctccaaagaaggaagtaaaaatctatgtgggcctcagcaaaatgcaa
agggaatggtatactcggatattaatgaaggatatagatatactcaactcagcaggcaag
atggacaaaatgaggttattgaacatcctaatgcagttgagaaaatgttgtaatcatcca
tatctctttgatggagcagaacctggtccaccttatacaacagatatgcatctagtaacc
aacagtggcaaaatggtggttttagacaagctgctccctaagttaaaagaacaaggttca
cgagtactaatcttcagtcaaatgacaagggtattggacattttggaagattattgcatg
tggagaaattatgagtactgcaggttggatggtcagacaccccatgatgagagacaagac
tccatcaatgcatacaatgaaccaaacagcacaaagtttgttttcatgttaagcacgcgt
gctggtggtcttggcatcaatcttgcgactgctgatgtagtaattttgtatgattctgat
tggaatccccaagtagatcttcaggctatggaccgagcacatagaattgggcagactaag
acagtcagagtgttccgctttataactgataacactgtagaagaaagaatagtagaacgt
gctgagatgaaactcagactggattcaatagtcattcaacaagggaggcttgtggatcag
aatctgaacaaaattgggaaagatgaaatgcttcaaatgattagacatggagcaacacat
gtgtttgcttcaaaggaaagtgagatcactgatgaagatatcgatggtattttggaaaga
ggtgcaaagaagactgcagagatgaatgaaaagctctccaagatgggcgaaagttcactt
agaaactttacaatggatacagagtcaagtgtttataacttcgaaggagaagactataga
gaaaaacaaaagattgcattcacagagtggattgaaccacctaaacgagaaagaaaagcc
aactatgccgttgatgcatatttcagggaagctcttcgtgttagtgaacctaaagcaccc
aaggctcctcgacctccaaaacaacccaatgttcaggatttccagttctttcctccacgt
ttatttgaattactggaaaaagaaattctgttttacagaaaaactattgggtacaaggta
cctcgaaatcctgagctgcctaacgcagcacaggcacaaaaagaagaacagcttaaaatt
gatgaagctgaatcccttaatgatgaagagttagaggaaaaagagaagcttctaacacag
ggatttaccaattggaataagagagattttaaccagtttatcaaagctaatgagaagtgg
ggtcgtgatgatattgaaaatatagcaagagaagtagaaggcaaaactccagaagaagtc
attgaatattcagctgtgttttgggaaaggtgcaacgagctccaggacatagagaagatt
atggctcagattgaaaggggagaggcgagaattcaaagaagaataagcatcaagaaagca
cttgacacaaagattggacggtacaaagcaccttttcatcagctgagaatatcatatggt
actaacaaaggaaaaaactatactgaagaagaagatcgttttctgatttgtatgcttcac
aaacttggatttgacaaagaaaatgtttatgatgaattgcgacagtgtattcgcaactct
cctcagttcagatttgactggtttcttaagtccagaactgcaatggagctccagaggaga
tgtaataccttaattactttgattgaaagagaaaacatggaactagaagaaaaggagaag
gcagagaaaaagaaacgaggaccaaagccttcaacacagaaacgtaaaatggatggcgca
cctgatggtcgaggaagaaaaaagaagctgaaactatga

DBGET integrated database retrieval system