KEGG   Homo sapiens (human): 84674
Entry
84674             CDS       T01001                                 

Gene name
CARD6, CINCIN1
Definition
(RefSeq) caspase recruitment domain family member 6
  KO
K12797  caspase recruitment domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    84674 (CARD6)
SSDB
Motif
Pfam: CARD
Other DBs
NCBI-GeneID: 84674
NCBI-ProteinID: NP_115976
OMIM: 609986
HGNC: 16394
Ensembl: ENSG00000132357
Vega: OTTHUMG00000094775
Pharos: Q9BX69(Tbio)
UniProt: Q9BX69
Position
5p13.1
AA seq 1037 aa
MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKL
LILVQKKGEATCQHFLKCLFSTFPQSAAICGLRHEVLKHENTVPPQSMGASSNSEDAFSP
GIKQPEAPEITVFFSEKEHLDLETSEFFRDKKTSYRETALSARKNEKEYDTPEVTLSYSV
EKVGCEVPATITYIKDGQRYEELDDSLYLGKEEYLGSVDTPEDAEATVEEEVYDDPEHVG
YDGEEDFENSETTEFSGEEPSYEGSETSLSLEEEQEKSIEERKKVFKDVLLCLNMDRSRK
VLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVLDEDSKEDLLA
GVENLEIRDIQTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM
LGAMKDIVKKQSTQFSGGPTEDTEKFLTLMKMPVISFVRLGYCSFSKSRILNTLLSPAQL
KLHKIFLHQDLPLLVLPRQISDGLVEITWCFPDSDDRKENPFFQKPVALANLRGNLESFW
TQFGFLMEVSSAVFFFTDCLGEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRIL
NLKPAQLLFWERGDAGDRRKNMEGLQAALQEVMFSSCLRCVSVEDMAALARELGIQVDED
FENTQRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALMPIQEPGTQCELSQNLQNLYG
TPVFRPVLENSWLFPTRIGGNFNHVSLKASWVMGRPFGSEQRPKWFHPLPFQNAGAQGRG
KSFGIQSFHPQIFYSGERFMKFSRVARGCHSNGTFGRLPRPICQHVQACPERPQMMGTLE
RSRAVASKIGHSYSLDSQPARAVGKPWPQQACTRVTELTEATGKLIRTSHIGKPHPQSFQ
PAAATQKLRPASQQGVQMKTQGGASNPALQIGSHPMCKSSQFKSDQSNPSTVKHSQPKPF
HSVPSQPKSSQTKSCQSQPSQTKPSPCKSTQPKPSQPWPPQSKPSQPRPPQPKSSSTNPS
QAKAHHSKAGQKRGGKH
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggctaccgagagtactccctcagagatcatagaaagagaaagaaaaaagttgcttgaa
atccttcaacatgatcctgattctatcttagacacgttaacttctcggaggctgatttct
gaggaagagtatgagactctggagaatgttacagatctcctgaagaaaagtcggaagctg
ttaattttggtacagaaaaagggagaggcgacctgtcagcattttctcaagtgtttattt
agtacttttccacagtcagctgccatttgcggcttaaggcatgaagttttaaaacatgag
aatacagtacctcctcaatctatgggggcaagcagtaattcagaagatgctttttctcct
ggaataaaacagcctgaagcccctgagatcacagtgttcttcagtgagaaggaacacttg
gatttggaaacctctgagtttttcagggacaagaaaactagttatagggaaacagctttg
tctgccaggaagaatgagaaggaatatgacacaccagaagtcacattatcatattcagtt
gagaaagttggatgtgaagttccagcaactattacatatataaaagatggacagagatat
gaggagctagatgattctttatacttaggaaaagaggaatatctaggatctgttgacacc
cctgaagatgcagaagccactgtggaagaggaggtttatgatgacccagagcacgttgga
tatgatggtgaagaggacttcgagaattcagaaaccacagagttctctggtgaagaacca
agttatgagggatcagaaaccagcctttcattggaggaggaacaggagaaaagtatagaa
gaaagaaaaaaggtgtttaaagatgtcctgttatgtttgaacatggatagaagcagaaag
gttctgccagattttgttaaacaattctccttagatcgaggatgtaagtggacccctgag
agtccaggagacttagcctggaatttcctgatgaaagttcaagcacgagatgtgacggct
agggattcaatcctcagtcacaaggttctggatgaagatagcaaggaggatttgctggct
ggagtggagaatttggaaattcgagacatacaaaccattaatccccttgacgtgctttgt
gccaccatgctgtgttcagatagctctttgcaacgccaagtcatgtcaaacatgtatcag
tgccagtttgctcttcccctgctactgccagatgcagaaaacaacaaaagcatcttaatg
ctgggggccatgaaagacattgtgaagaagcagtcaacacagttttcaggggggcctaca
gaggatacagaaaagtttctgactctcatgaagatgcctgtcatctcttttgtgcgtcta
ggatactgtagcttctctaagtccagaatcctcaacacacttctcagccctgcccagttg
aaattacacaaaatctttcttcatcaagatttgcctcttttggtgcttccccggcaaatc
tctgatggcctggttgagataacatggtgttttcctgatagcgatgatagaaaggaaaac
ccctttttccaaaagcctgttgctctggctaatctccgtggaaatctagaaagcttttgg
actcagtttggttttttgatggaagtttcttcagctgtgttttttttcactgactgttta
ggtgagaaggaatgggacttgctaatgtttttaggagaggctgccattgaaagatgctac
tttgttctcagttcccaagccagggagagtgaagaggctcaaatttttcagaggatactg
aacttgaagccagcacagctactgttttgggagaggggagatgctggggatagaaggaag
aacatggagggccttcaagctgccctccaggaagtgatgttctcttcttgcctcagatgt
gtgtctgtggaggatatggccgccctggccagggagctggggattcaggtagatgaagac
tttgaaaacactcagagaattcaagtttcctctggagaaaacatggctgggacagctgaa
ggtgagggtcagcaaagacacagtcagctaaaaagctcatctaaaagccaggctctaatg
ccaattcaagagcctgggactcaatgtgagctcagccagaatcttcagaatctctatggt
accccagtattcaggcctgttctagagaactcctggctctttccaaccagaattggaggt
aactttaaccatgtttccttgaaagcctcctgggttatgggccgcccctttgggtcagag
cagaggcctaagtggttccatcctttgccttttcagaatgcaggggcccagggccgaggt
aaaagttttggtattcaatccttccatccccagatattttattcaggtgaaagattcatg
aaattttccagagttgctcggggatgtcactcgaatggaacatttgggagactgccaaga
cccatttgtcagcatgtacaggcctgccctgagagaccacaaatgatgggaactcttgaa
aggtctagggcagtagcctccaagataggtcactcctattccctggattcacagccagca
agagcagtagggaagccatggcctcagcaagcttgcaccagggtaacagagttaactgaa
gcaactggaaaactgataagaacatcccatattggaaagcctcaccctcagtcctttcaa
ccagcagcagccacacaaaaactaagacctgcttctcagcaaggagtccagatgaagaca
caaggtggggcttcaaatccagctctccaaatagggtcccatcccatgtgcaagagctct
cagttcaaatccgatcagtccaacccatccacagtcaaacactcccagcctaaacccttc
cattctgtgccctctcaacctaaatcctctcagacaaaatcctgtcagtcccagccctcc
caaactaaaccttctccatgcaaatctactcagcctaagccaagccagccctggcctccc
cagtctaagccttctcagcccagaccccctcaacctaagtcatcctcaaccaatccttca
caagctaaggcacaccactcaaaagcagggcagaagaggggagggaagcattaa

DBGET integrated database retrieval system