KEGG   Homo sapiens (human): 84675
Entry
84675             CDS       T01001                                 
Symbol
TRIM55, MURF-2, RNF29, muRF2
Name
(RefSeq) tripartite motif containing 55
  KO
K10654  tripartite motif-containing protein 55
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01821  Sarcomere, M-band
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    84675 (TRIM55)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84675 (TRIM55)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    84675 (TRIM55)
SSDB
Motif
Pfam: zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-B_box zf-RING_2 zf-RING_5 zf-C3HC4_4 zf-C3HC4_3 zf-RING_6 Sina_RING Cbl_N
Other DBs
NCBI-GeneID: 84675
NCBI-ProteinID: NP_908973
OMIM: 606469
HGNC: 14215
Ensembl: ENSG00000147573
UniProt: Q9BYV6
Position
8:66113351..66175485
AA seq 548 aa
MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNP
YLPTRGGTTMASGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSD
QPMCEEHEEERINIYCLNCEVPTCSLCKVFGAHKDCQVAPLTHVFQRQKSELSDGIAILV
GSNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEK
LEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQNAKTLLKKISEASKAFQMEKI
EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVGGEAVEVEEVE
NVQTEFPGEDENPEKASELSQVELQAAPGALPVSSPEPPPALPPAADAPVTQGEVVPTGS
EQTTESETPVPAAAETADPLFYPSWYKGQTRKATTNPPCTPGSEGLGQIGPPGSEDSNVR
KAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSF
SWLNSLNE
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagcgcatctctgaattacaaatctttttccaaagagcagcagaccatggataactta
gagaagcaactcatctgtcccatctgcttagagatgttcacgaaacctgtggtgattctc
ccttgtcagcacaacctgtgtaggaaatgtgccagtgatattttccaggcctctaacccg
tatttgcccacaagaggaggtaccaccatggcatcagggggccgattccgctgcccatcc
tgtagacatgaagtggttttggatagacatggggtatatggacttcagaggaacctgctg
gtggaaaatatcattgacatctacaagcaggagtccaccaggccagaaaagaaatccgac
cagcccatgtgcgaggaacatgaagaggagcgcatcaacatctactgtctgaactgcgaa
gtacccacctgctctctgtgcaaggtgtttggtgcacacaaagactgccaggtggctccc
ctcactcatgtgttccagagacagaagtctgagctcagtgatggcatcgccatcctcgtg
ggcagcaacgatcgagtccagggagtgatcagccagctggaagacacctgcaaaactatc
gaggaatgttgcagaaaacagaaacaagagctttgtgagaagtttgattacctgtatggc
attttggaggagaggaagaatgaaatgacccaagtcattacccgaacccaagaggagaaa
ctggaacatgtccgtgctctgatcaaaaagtattctgatcatttggagaacgtctcaaag
ttggttgagtcaggaattcagtttatggatgagccagaaatggcagtgtttctgcagaat
gccaaaaccctgctaaaaaaaatctcggaagcatcaaaggcatttcagatggagaaaata
gaacatggctatgagaacatgaaccacttcacagtcaacctcaatagagaagaaaagata
atacgtgaaattgacttttacagagaagatgaagatgaagaagaagaagaaggcggagaa
ggagaaaaagaaggagaaggagaagtgggaggagaagcagtagaagtggaagaggtagaa
aatgttcaaacagagtttccaggagaagatgaaaacccagaaaaagcttcagagctctct
caggtggagctgcaggctgcccctggggcacttccagtttcctctccagagccacctcca
gccctgccacctgctgcggatgcccctgtgacacagggggaggttgtacccactggctct
gagcagaccacagagtctgaaactccagtccctgcagcagcagaaactgcggatcccttg
ttttaccctagttggtataaaggccaaacccggaaagccaccaccaacccaccttgcacc
ccagggagcgaaggtctggggcaaatagggcctccaggttctgaggattcgaatgtacgg
aaggcagaagtggcagcagccgcagcgagtgagagggcagctgtgagtggtaaggaaact
agtgcacctgcagctacttctcagattggatttgaggctcctcccctccagggacaggct
gcagctccagcgagtggcagtggagctgattctgagccagctcgccatatcttctccttt
tcctggttgaactccctaaatgaatga

DBGET integrated database retrieval system