KEGG   Homo sapiens (human): 84676
Entry
84676             CDS       T01001                                 
Symbol
TRIM63, IRF, MURF1, MURF2, RNF28, SMRZ
Name
(RefSeq) tripartite motif containing 63
  KO
K10655  tripartite motif-containing protein 63 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01821  Sarcomere, M-band
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    84676 (TRIM63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84676 (TRIM63)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84676 (TRIM63)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    84676 (TRIM63)
SSDB
Motif
Pfam: zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-B_box zf-RING_5 zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-RING_6 Sina_RING Fzo_mitofusin DUF1664 ATP-synt_E_2 ANCHR-like_BBOX Phasin Spt4 Allexi_40kDa
Other DBs
NCBI-GeneID: 84676
NCBI-ProteinID: NP_115977
OMIM: 606131
HGNC: 16007
Ensembl: ENSG00000158022
UniProt: Q969Q1
Position
1:complement(26051301..26067630)
AA seq 353 aa
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggattataagtcgagcctgatccaggatgggaatcccatggagaacttggagaagcag
ctgatctgccctatctgcctggagatgtttaccaagccagtggtcatcttgccgtgccag
cacaacctgtgccggaagtgtgccaatgacatcttccaggctgcaaatccctactggacc
agccggggcagctcagtgtccatgtctggaggccgtttccgctgccccacctgccgccac
gaggtgatcatggatcgtcacggagtgtacggcctgcagaggaacctgctggtggagaac
atcatcgacatctacaaacaggagtgctccagtcggccgctgcagaagggcagtcacccc
atgtgcaaggagcacgaagatgagaaaatcaacatctactgtctcacgtgtgaggtgccc
acctgctccatgtgcaaggtgtttgggatccacaaggcctgcgaggtggccccattgcag
agtgtcttccagggacaaaagactgaactgaataactgtatctccatgctggtggcgggg
aatgaccgtgtgcagaccatcatcactcagctggaggattcccgtcgagtgaccaaggag
aacagtcaccaggtaaaggaagagctgagccagaagtttgacacgttgtatgccatcctg
gatgagaagaaaagtgagttgctgcagcggatcacgcaggagcaggagaaaaagcttagc
ttcatcgaggccctcatccagcagtaccaggagcagctggacaagtccacaaagctggtg
gaaactgccatccagtccctggacgagcctgggggagccaccttcctcttgactgccaag
caactcatcaaaagcattgtggaagcttccaagggctgccagctggggaagacagagcag
ggctttgagaacatggacttctttactttggatttagagcacatagcagacgccctgaga
gccattgactttgggacagatgaggaagaggaagaattcattgaagaagaagatcaggaa
gaggaagagtccacagaagggaaggaagaaggacaccagtaa

DBGET integrated database retrieval system