KEGG   Homo sapiens (human): 84688
Entry
84688             CDS       T01001                                 
Symbol
C9orf24, CBE1, NYD-SP22, SMRP1, bA573M23.4
Name
(RefSeq) chromosome 9 open reading frame 24
  KO
K18634  spermatid-specific manchette-related protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    84688 (C9orf24)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     84688 (C9orf24)
SSDB
Motif
Pfam: SMRP1 KRTAP7
Other DBs
NCBI-GeneID: 84688
NCBI-ProteinID: NP_115985
OMIM: 619502
HGNC: 19919
Ensembl: ENSG00000164972
Pharos: Q8NCR6(Tdark)
UniProt: Q8NCR6
Position
9:complement(34379019..34397810)
AA seq 262 aa
MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHTMERHVDPEAL
QKMAKCAVQDYTYRGSISGHPYLPEKYWLSQEEADKCSPNYLGSDWYNTWRMEPYNSSCC
NKYTTYLPRLPKEARMETAVRGMPLECPPRPERLNAYEREVMVNMLNSLSRNQQLPRITP
RCGCVDPLPGRLPFHGYESACSGRHYCLRGMDYYASGAPCTDRRLRPWCREQPTMCTSLR
APARNAVCCYNSPAVILPISEP
NT seq 789 nt   +upstreamnt  +downstreamnt
atgttcctgttctcccgtaagaccaggacccctatcagtacctacagtgactcctacagg
gctcccacctccatcaaggaggtctataaggacccacccctgtgtgcctgggaagccaac
aagtttctgactccgggtctgactcataccatggagcgacatgtggatcccgaagccctg
cagaagatggccaaatgtgctgtacaggactacacttatagggggtccatatcaggccac
ccctacttgcctgagaagtactggctttctcaagaggaagcagacaaatgcagcccaaac
tacctgggcagtgactggtacaacacatggaggatggaaccttacaacagcagctgctgc
aacaagtataccacctaccttcctcggctgcctaaggaggccaggatggagacagcagtt
cgaggaatgcccttggaatgccctcctaggccggagcggctcaatgcctacgagcgcgaa
gtgatggtgaacatgctgaactcactgtcgcggaaccagcagctgccgcggatcacgccc
cgatgcgggtgcgtggacccgctgcccggccgcctgcccttccatggttacgaaagtgct
tgctcgggccgccactactgtctgcgcgggatggactactacgccagcggggcgccctgc
accgaccgccgcctgcggccttggtgccgggagcaaccgactatgtgtacctccctacga
gcaccggcccggaatgcagtgtgctgttacaactcccccgccgtcatactacccatatcc
gaaccttag

DBGET integrated database retrieval system