KEGG   Homo sapiens (human): 84705Help
Entry
84705             CDS       T01001                                 

Gene name
GTPBP3, COXPD23, GTPBG3, MSS1, MTGP1, THDF1
Definition
(RefSeq) GTP binding protein 3, mitochondrial
  KO
K03650  tRNA modification GTPase [EC:3.6.-.-]
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    84705 (GTPBP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     84705 (GTPBP3)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    84705 (GTPBP3)
 Prokaryotic Type
   Methyltransferases
    84705 (GTPBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MnmE_helical TrmE_N MMR_HSR1 Dynamin_N FeoB_N AAA_28 AAA_16 RsgA_GTPase AAA_18 NTPase_P4 RuvB_N MCM
Motif
Other DBs
NCBI-GeneID: 84705
NCBI-ProteinID: NP_116009
OMIM: 608536
HGNC: 14880
Ensembl: ENSG00000130299
Vega: OTTHUMG00000182766
Pharos: Q969Y2(Tbio)
UniProt: Q969Y2
Position
19p13.11
AA seq 492 aa AA seqDB search
MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGSGATIFALSSGQGRCGIAVIRTSGPASGH
ALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQADIEVRALQVALGAHLRDA
RRGQRLRSGVHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVL
LSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVASVGAQ
SPSDSSQRLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLTGEGLDGLLEALRKELAAVCG
DPSTDPPLLTRARHQHHLQGCLDALGHYKQSKDLALAAEALRVARGHLTRLTGGGGTEEI
LDIIFQDFCVGK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggggctttggaccctggcggcccaagcggcacgtgggcctcgcagattgtgc
acgcgccggagcagcggcgcaccagcccccggctccggcgccaccatcttcgcgctaagc
tctggccaaggccgctgcggcatcgcagtgatccggaccagcggccccgccagcggccac
gccctccgaattctcacagcaccccgagacctgccccttgctcgccacgccagcctgcgc
ctgctcagcgatccccgctccggggagcctctggaccgcgcactggtgctctggttccca
ggtccccagagtttcaccggtgaggactgcgtggagttccacgtgcatggaggcccggca
gtggtgagcggcgtcctgcaggccttgggcagcgtgccagggcttcgaccggcggaggca
ggcgagttcaccagacgggcgttcgccaatgggaagctgaacctgaccgaagtggagggg
ctggcggaccttatccacgcggaaacagaggcgcagcggcggcaggccctcaggcagctg
gacggagagctgggccacctctgccgtggctgggccgagaccctcaccaaagctctggcc
cacgtggaggcctatatcgatttcggcgaggatgacaacctggaggagggggtcctggag
caagccgacatcgaagtacgggcactgcaggtggccctgggtgcacatctacgagatgcc
aggcgcgggcagaggctccgctcaggggtgcacgtagtggtcactggaccccccaatgcg
ggcaagagcagcctagtgaacctgctcagtcggaagcctgtgtccatcgtgtccccggag
ccagggaccacccgtgacgtgctggagaccccagtcgacctggccggatttcctgtgctg
ctgagcgacacggctgggttgcgggagggcgtggggcccgtggagcaggagggcgtgcgg
cgcgcccgggagaggctagagcaggctgacctcattctggccatgctggatgcttctgac
ctggcctctccctccagttgcaacttcctggccaccgtcgtagcctctgtgggagcccag
agccccagtgacagcagccagcgcctcctcctggtgctgaacaagtcggacctgctgtcc
ccggagggcccaggtcccggtcctgacctgcccccgcacctgctgctgtcctgtctgacg
ggagaggggctggacggcctcctggaggcgctgaggaaggagctagctgcagtgtgtggg
gacccgtccacagatcccccgctgctgacccgagcaaggcaccagcaccacctccagggt
tgcctggatgccctcggccactacaagcagtcaaaagacctggccctggcggcagaggcg
ctgcgggtggcccggggtcacctgacccggctcacaggtggagggggtaccgaggagatc
ctggacatcatcttccaggacttctgtgtgggcaagtga

DBGET integrated database retrieval system