KEGG   Homo sapiens (human): 8471
Entry
8471              CDS       T01001                                 

Gene name
IRS4, CHNG9, IRS-4, PY160
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04068  FoxO signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04910  Insulin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04935  Growth hormone synthesis, secretion and action
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    8471 (IRS4)
   04022 cGMP-PKG signaling pathway
    8471 (IRS4)
   04152 AMPK signaling pathway
    8471 (IRS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8471 (IRS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8471 (IRS4)
   04923 Regulation of lipolysis in adipocytes
    8471 (IRS4)
   04920 Adipocytokine signaling pathway
    8471 (IRS4)
   04935 Growth hormone synthesis, secretion and action
    8471 (IRS4)
  09149 Aging
   04211 Longevity regulating pathway
    8471 (IRS4)
   04213 Longevity regulating pathway - multiple species
    8471 (IRS4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    8471 (IRS4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8471 (IRS4)
SSDB
Motif
Pfam: IRS PH_11 PH_8
Other DBs
NCBI-GeneID: 8471
NCBI-ProteinID: NP_003595
OMIM: 300904
HGNC: 6128
Ensembl: ENSG00000133124
Vega: OTTHUMG00000022181
Pharos: O14654(Tbio)
UniProt: O14654
Position
Xq22.3
AA seq 1257 aa
MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTAT
GSRSDSESEEEDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAIPPLIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTLGAQPDGEPAALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSARRH
LGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQ
EGSGGDYMPMNNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGS
GGNQCSRDGQGTAGGHGSGGGQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGS
DGDGERGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGGTGGKGKSGGRFRLYFCVD
RGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPYVPMRPGVATPLVSSSDYMPM
APQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDSKDNDSESDYM
FMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYK
IKPKPQKPTHEQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYV
NVEFGVPFPNPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVI
FNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQ
ERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAVASAAEPTLALSQVVAAASAL
AAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAHNPSANLARGD
NQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR
NT seq 3774 nt   +upstreamnt  +downstreamnt
atggcgagttgctccttcactcgcgaccaagcgacaagaagactaagaggtgcagcagcg
gcggcagcggcagctctagcagcagtggtgaccaccccgcttctttcctcgggaaccccg
accgcactcattgggaccgggtcgtcttgtccgggagccatgtggctctccacggccact
ggctcccggtcagactccgagtccgaagaggaggacctgcccgtcggggaggaagtctgc
aaacgcggctacctgcggaaacagaagcatgggcacaggcgctacttcgtgctcaaactc
gagactgctgacgccccagctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgccgcggcggctgcagcagcggcggccgcctctggcgccgcgatccccccg
ctcattccaccgcggcgcgtgatcaccctataccagtgcttttccgtgagccagcgagca
gatgcaaggtaccgacacctcattgctcttttcacccaagacgaatacttcgcgatggtg
gccgagaacgagtcggagcaggaaagctggtacttgctgctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacgctcggcgcgcagccggacggagagccggccgcgctg
gcggcggcagcggcggcggagccacccttctataaagatgtgtggcaggtaatagtcaaa
cccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtctaaccgac
gaggaggtcgtgtttgtgaggctgaacaccgaagtggccagcgtggtcgtccagctcctg
agcatccgtcgctgtggacactcggagcagtatttcttcttggaagtaggcaggtccact
gtcatcggtccgggagagctctggatgcaggtcgatgactgtgtggttgcccaaaacatg
catgagctgtttttggagaagatgagagccttgtgtgcagacgaatacagagcccgctgc
cgcagctacagcatcagcatcggcgcccacctgttaaccctgctgtccgctaggaggcac
ctgggcttggtgccgctcgagccgggaggctggctcagaaggtcccgctttgagcagttt
tgccacctcagggccatcggcgacggggaagacgagatgcttttcaccaggcgcttcgta
acacccagcgagcctgtggcccactccaggcgaggaagactgcacctgcccagagggcgc
aggtcaaggagagcggtttcagtgccggccagcttttttcgccgcttagcacccagccca
gcacgtccccggcaccctgcagaagccccgaacaatggagctcgcctgtcttctgaagtg
tctggttctggctctggcaactttggggaggaaggcaatccccagggcaaagaagatcag
gaaggaagcggaggtgactacatgcctatgaacaattggggctcaggaaatggccggggc
tcaggaggtggccagggctcaaatggccaaggctccagtagccatagctcgggaggaaac
cagtgttcaggcgagggacagggatcccgaggtggtcagggctcaaatggccagggctca
ggaggaaaccagtgctctagagatggccagggcaccgcaggtgggcacggttcaggtggt
ggccagagacctggaggtgggcatggctcaggtggtggccagggacctggagatggccat
ggctcaggtggtggcaagaactctggggggggcaaaggctcaggaagtgggaaaggatcc
gatggtgatggtgaacgtggaaaatctctgaagaaaagatcctattttggcaaattaact
caaagcaagcaacagcaaatgccaccacctccaccacctcctcctccacccccaccagct
ggaggaactggtggaaaagggaagtctgggggaagattcagactttatttttgtgttgac
agaggagccacgaaagaatgcaaagaagccaaagaagtgaaagatgcagagatcccagaa
ggtgcagctcgaggtccccacagagccagagcttttgatgaagatgaggatgacccatac
gtgccaatgaggccaggggtggccacccctcttgtaagctccagtgattatatgccaatg
gctcctcaaaatgtctctgcttcaaaaaagcgccactctcgatccccttttgaagattca
agagggtacatgatgatgtttcccagagtgagcccaccacctgctccgagtcctccaaaa
gcacctgatactaataaagaggatgactcaaaggacaatgacagtgagagtgactacatg
tttatggctcctggagccggtgcaattccaaaaaaccccagaaatcctcagggtggctct
tcctccaaaagttggagctcctacttctctctaccaaacccttttcggagctcacctttg
ggacagaatgacaacagtgagtatgtgccaatgttacctggaaagttcctggggaggggc
ctagacaaagaagtctcctataactgggaccccaaagatgcagcttcaaagccttcaggt
gagggatcattctcaaagcctggagatgggggatcaccttcaaagccttcagatcatgag
cccccaaagaataaagctaagagacctaaccgactttcttttattacaaaaggatataaa
atcaagccaaaaccacaaaagcccacacatgagcagagagaagctgacagctctagtgac
tacgtcaacatggacttcactaaaagagagagcaatacaccagctccctctactcaagga
ctaccagattcgtggggcataattgctgaacccagacagtcagccttttctaattatgtg
aatgttgagtttggagtgccatttccaaatccagcaaacgacctctcagatcttttaaga
gctataccacgtgccaaccccttatctctggacagtgctaggtggccacttcctcccctt
cccctcagtgctacaggtagcaatgctattgaggaagagggtgactacattgaagtaatt
ttcaactcagcaatgacaccagccatggctcttgctgacagtgccattcgctatgatgct
gaaacaggtcgaatctatgtggtcgacccattttctgagtgctgtatggatatttctctc
tcccccagccgatgttctgaaccaccacctgtagctaggctgctgcaggaagaagagcag
gagagaagacgcccacaaagccgttctcaaagtttctttgcagcagccagagccgctgtc
tctgcttttccaacagacagcctcgagagagacctttccccatcctcagccccggctgtc
gcttcggctgcagagccgactttagccctcagccaagttgtagctgcggcctccgcgctc
gccgcagccccgggcatcggcgcagcagccgcagctgctggatttgactccgcctctgcc
cgctggtttcaacctgttgctaatgctgctgatgccgaagcagtaaggggagcccaagac
gttgccggtggctcgaaccctggagcccacaacccatctgcaaaccttgccagaggtgat
aaccaggctggcggggctgccgctgcagctgccgctccggaaccaccacctcgcagtcgc
cgggtgccaagacccccggagagagaagattctgacaacgacgacgacactcacgtgaga
atggattttgccagacgtgataatcagttcgactctcccaaaagaggtcggtaa

DBGET integrated database retrieval system