KEGG   Homo sapiens (human): 84725Help
Entry
84725             CDS       T01001                                 

Gene name
PLEKHA8, FAPP2
Definition
(RefSeq) pleckstrin homology domain containing A8
  KO
K08051  pleckstrin homology domain containing family A member 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84725 (PLEKHA8)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   Others
    84725 (PLEKHA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GLTP PH PH_8 PH_11 PH_3
Motif
Other DBs
NCBI-GeneID: 84725
NCBI-ProteinID: NP_001183955
OMIM: 608639
HGNC: 30037
Ensembl: ENSG00000106086
Vega: OTTHUMG00000097751
Pharos: Q96JA3(Tbio)
UniProt: Q96JA3 A0A2P1JJM6
Structure
PDB: 

Position
7p14.3
AA seq 519 aa AA seqDB search
MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTR
MDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSEL
RLYCDLLVQQVDKTKEVTTTGVSNSEEGIDVGTLLKSTCNTFLKTLEECMQIANAAFTSE
LLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNK
NSLYLKSAEIDCSISSEENTDDNITVQGEIRKEDGMENLKNHDNNLTQSGSDSSCSPECL
WEEGKEVIPTFFSTMNTSFSDIELLEDSGIPTEAFLASCYAVVPVLDKLGPTVFAPVKMD
LVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADVAQVRNSATEALLWLKRGLKFLKGFLT
EVKNGEKDIQTALNNAYGKTLRQHHGWVVRGVFALALRAAPSYEDFVAALTVKEGDHQKE
AFSIGMQRDLSLYLPAMEKQLAILDTLYEVHGLESDEVV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagggggtgctgtacaagtggaccaactatctgagcggttggcagcctcgatggttc
cttctctgtgggggaatattgtcctattatgattctcctgaagatgcctggaaaggttgc
aaagggagcatacaaatggcagtctgtgaaattcaagttcattctgtagataatacacgc
atggacctgataatccctggggaacagtatttctacctgaaggccagaagtgtggctgaa
agacagcggtggctggtggccctgggatcagccaaggcttgcctgactgacagtaggacc
cagaaggagaaagagtttgctgaaaacactgaaaacttgaaaaccaaaatgtcagaacta
agactctactgtgacctccttgttcagcaagtagataaaacaaaagaagtgaccacaact
ggtgtgtccaattctgaggagggaattgatgtgggaactttgctgaaatcaacctgtaat
acttttctgaagaccttggaagaatgcatgcagatcgcaaatgcagccttcacctctgag
ctgctctaccgcactccaccaggatcacctcagctggccatgctcaagtccagcaagatg
aaacatcctattataccaattcataattcattggaaaggcaaatggagttgagcacttgt
gaaaatggatctttaaatatggaaataaatggtgaggaagaaatcctaatgaaaaataag
aattccttatatttgaaatctgcagagatagactgcagcatatcaagtgaggaaaataca
gatgataatataacagtccaaggtgaaataaggaaggaagatggaatggaaaacctgaaa
aatcatgacaataacttgactcagtctggatcagactcaagttgctctccggaatgcctc
tgggaggaaggcaaagaagttatcccaactttctttagtaccatgaacacaagctttagt
gacattgaacttctggaagacagtggcattcccacagaagcattcttggcatcatgttat
gctgtggttccagtattagacaaacttggccctacagtgtttgctcctgttaagatggat
cttgttggaaatattaagaaagtaaatcagaagtatataaccaacaaagaagagtttacc
actctccagaagatagtgctgcacgaagtggaggcggatgtagcccaggttaggaactca
gcgactgaagccctcttgtggctgaagagaggtctcaaatttttgaagggatttttgaca
gaagtgaaaaatggggagaaggatatccagacagccctaaataatgcatatggtaaaaca
ttgcggcaacaccatggctgggtagttcgaggggtttttgcgttagctttaagggcagct
ccatcctatgaagattttgtggccgcgttaaccgtaaaggaaggtgaccaccagaaagaa
gctttcagtattgggatgcagagggacctcagcctttacctccctgccatggagaagcag
ctggccatactggacactttatatgaggtccacgggctggaatctgatgaggtggtatga

DBGET integrated database retrieval system