KEGG   Homo sapiens (human): 84726
Entry
84726             CDS       T01001                                 
Symbol
PRRC2B, BAT2L, BAT2L1, KIAA0515, LQFBS-1
Name
(RefSeq) proline rich coiled-coil 2B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BAT2_N
Other DBs
NCBI-GeneID: 84726
NCBI-ProteinID: NP_037450
OMIM: 619544
HGNC: 28121
Ensembl: ENSG00000288701
Pharos: Q5JSZ5(Tdark)
UniProt: Q5JSZ5 Q9BU62
Position
9:131373651..131500193
AA seq 2229 aa
MSDRLGQITKGKDGKSKYSTLSLFDKYKGKSVDAIRSSVIPRHGLQSLGKVAAARRMPPP
ANLPSLKSENKGNDPNIVIVPKDGTGWANKQDQQDPKSSSATASQPPESLPQPGLQKSVS
NLQKPTQSISQENTNSVPGGPKSWAQLNGKPVGHEGGLRGSSRLLSFSPEEFPTLKAAGG
QDKAGKEKGVLDLSYGPGPSLRPQNVTSWREGGGRHIISATSLSTSPTELGSRNSSTGDG
APSSACTSDSKDPSLRPAQPVRKGASQFMGNVYHPPTYHDMLPAFMCSPKSSENQGTVER
GSFPLPQLRLEPRVPFRQFQMNDQDGKENRLGLSRPLRPLRQLVERAPRPTIINAENLKG
LDDLDADADDGWAGLHEEVDYSEKLKFSDDEEEEEVVKDGRPKWNSWDPRRQRQLSMSSA
DSADAKRTREEGKDWAEAVGASRVVRKAPDPQPPPRKLHGWAPGPDYQKSSMGSMFRQQS
IEDKEDKPPPRQKFIQSEMSEAVERARKRREEEERRAREERLAACAAKLKQLDQKCKQAR
KAGEARKQAEKEVPWSPSAEKASPQENGPAVHKGSPEFPAQETPTTFPEEAPTVSPAVAQ
SNSSEEEAREAGSPAQEFKYQKSLPPRFQRQQQQQQQEQLYKMQHWQPVYPPPSHPQRTF
YPHHPQMLGFDPRWMMMPSYMDPRITPTRTPVDFYPSALHPSGLMKPMMPQESLNGTGCR
SEDQNCVPPLQERKVTPIDSPPVWSPEGYMALQSKGYPLPHPKSSDTLAMDMRVRNESSF
SASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDA
GAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQPETADTAHGVERETPREGTAFNIS
SWDKNGSPNKQPSSEPEWTPEPRSSSSQHPEQTGRTRRSGPIKKPVLKALKVEDKEKELE
KIKQELGEESTRLAKEKEQSPTAEKDEDEENDASLANSSTTTLEDKGPGHATFGREATKF
EEEEKPDKAWEARPPRESSDVPPMKRNNWIFIDEEQAFGVRGQARGRGRGFREFTFRGRP
AGGNGSGLCGGGVLGARSIYCSSQRSGRGRGLREFARPEDCPRAKPRRRVASETHSEGSE
YEELPKRRRQRGSENGNEGSLLEREESTLKKGDCRDSWRSNKGCSEDHSGLDAKSRGPRA
FGRALPPRLSNCGYGRRTFVSKESPHWQSKSPGSSWQEYGPSDTCGSRRPTDRDYVPDSY
RHPDAFGGRGFEDSRAEDKRSFFQDEHVADSENAENRPFRRRRPPRQDKPPRFRRLRQER
ESLGLWGPEEEPHLLAGQWPGRPKLCSGDKSGTVGRRSPELSYQNSSDHANEEWETASES
SDFSERRERREGPGSEPDSQVDGGLSGASLGEKKELAKRSFSSQRPVVDRQSRKLEPGGF
GEKPVRPGGGDTSPRYESQQNGTPLKVKRSPDEALPGGLSGCSSGSGHSPYALERAAHAS
ADLPEASSKKAEKEAKLAAPRAGEQGEAMKQFDLNYGSAIIENCGSSPGEESEVGSMVGE
GFIEVLTKKQRRLLEEERRKKEQAVQVPVKGRGLSSRIPPRFAKKQNNLCLEQGDVTVPG
SSLGTEIWESSSQALPVQAPANDSWRKAVTAFSSTETGSAEQGFKSSQGDSGVDLSAESR
ESSATSSQRSSPYGTLKPEEMSGPGLAEPKADSHKEQAPKPSEQKDSEQGSGQSKEHRPG
PIGNERSLKNRKGSEGAERLQGAVVPPVNGVEIHVDSVLPVPPIEFGVSPKDSDFSLPPG
SASGPTGSPVVKLQDALASNAGLTQSIPILRRDHHIQRAIGLSPMSFPTADLTLKMESAR
KAWENSPSLPEQSSPGGAGSGIQPPSSVGASSGVNYSSFGGVSMPPMPVASVAPSASMPG
SHLPPLYLDGHVFASQPRLVPQTIPQQQSYQQAAAAQQIPISLHTSLQAQAQLGLRGGLP
VSQSQEIFSSLQPFRSQVYMHPSLSPPSTMILSGGTALKPPYSAFPGMQPLEMVKPQSGS
PYQPMSGNQALVYEGQLSQAAGLGASQMLDSQLPQLTMPLPRYGSGQQPLILPQSIQLPP
GQSLSVGAPRRIPPPGSQPPVLNTSREPSQMEMKGFHFADSKQNVPSGGPVPSPQTYRPS
SASPSGKPSGSAVNMGSVQGHYVQQAKQRVDEKPSLGAVKLQEAPSAASQMKRTGAIKPR
AVKVEESKA
NT seq 6690 nt   +upstreamnt  +downstreamnt
atgtccgatcgtttggggcaaattaccaagggcaaggatgggaaaagcaagtactcgact
ctcagcctgtttgataagtataaaggaaaatcagtagacgcgattagatcctcagttatt
cctagacatggcttacagagtcttgggaaagttgctgcagcccggcgcatgccaccgcct
gcaaacctgccaagcttgaagtctgaaaacaaaggaaacgaccccaacatcgtgatagta
cccaaggacgggacgggatgggcaaacaagcaggatcagcaagacccaaagagttccagt
gcgacggcctctcagccgccggagtcgctgccgcagccgggtttgcagaaatctgtctcc
aatttgcagaaaccgacacagtcaatcagtcaggagaatacaaattcagtgccaggtgga
ccaaagtcatgggcacagctgaatggaaagccagtaggacacgaaggtggtttaaggggc
tcaagccgactgttatccttctctcccgaggaatttccgacgctgaaagcagctggaggg
caggacaaggctggcaaagaaaagggcgtcttagatctgtcgtatgggccaggaccaagc
ctccgccctcagaatgtgacaagctggagggagggcggtgggcgacacataatttctgcc
acgtctctgagcacctccccaactgagctgggcagcaggaactcgagtacgggagatgga
gccccctcctcggcatgtaccagcgattctaaggacccctctctccgcccggctcagcct
gtccgaaaaggggcttcacagttcatgggaaatgtataccacccacctacataccatgac
atgcttcctgcttttatgtgttcgccgaagtcatcagaaaaccagggtacagtggaacga
ggctcttttccccttcctcagctccgccttgaacctcgagttccttttagacagttccag
atgaatgaccaagacggaaaagaaaacaggctgggattgtctcgcccactccgcccacta
aggcagctggtggagcgggcaccacggcccaccattatcaatgcggaaaacctgaagggc
cttgacgatctggacgccgatgccgatgatggctgggcaggcctccatgaagaagtggac
tattctgagaaactgaagttcagtgatgatgaagaggaggaagaagttgtgaaggacggc
aggccaaagtggaacagttgggaccctaggaggcagcggcagttgtcaatgagctctgca
gacagtgcggacgctaagcggactcgagaggaagggaaggactgggctgaagcagtgggt
gcgtcccgtgtggtccgaaaggcgccagaccctcagccaccgcccaggaagcttcatggc
tgggcaccaggccctgactaccagaagtcatcaatgggcagcatgttccggcaacagtcc
atcgaggacaaggaggacaagcccccaccaaggcagaagttcattcagtcagagatgtcc
gaggcggtggagcgagcccgaaagcgccgggaagaagaggagcgccgagcccgggaggag
aggctggccgcctgtgctgccaaactcaagcagctggaccagaagtgtaagcaggcacga
aaggcaggtgaggcccggaagcaggcagagaaggaagtgccctggtctccaagtgctgag
aaggcatctccccaggaaaacggccctgctgtccacaaaggctccccagaattccctgcc
caagagacccccaccacattcccagaagaggcacccacagtgtccccagcagtggcacag
agcaacagcagtgaggaagaggccagagaggctgggtcccctgcacaggagttcaagtat
cagaagtcccttcctccccgattccagcgccagcagcagcaacaacagcaggagcagctg
tacaagatgcagcactggcagccggtgtaccccccgccgtcccacccccagcgcaccttt
tacccacaccacccccagatgttgggcttcgatcccaggtggatgatgatgccttcctac
atggacccacgtatcacgcccactcggaccccggtggacttctacccctccgccctgcat
ccctcaggactgatgaagcccatgatgccccaggagtccctcaatgggacaggctgtcgc
tctgaggatcagaactgtgtgcccccactccaagaaagaaaagtgacccccatcgactca
ccccctgtgtggagcccagagggctacatggcactgcagagcaagggctacccgctcccg
cacccgaagtcgagtgacaccttggctatggacatgcgtgtcaggaatgaaagctctttc
tctgcctcactcggaagggcagggggcgtaagtgctcagcgcgatctctttgaggagaga
ggggaggagtacttgagtgcttttgacaagaaggcccaagcagactttgacagctgtatc
tcttctcaaagaataggccaggagcttttgtttccaccccaagaaaatgttcaggatgca
ggtgctcctgggggtcacacccaaaacctcaggtgttccccattggagcctgactttgtc
ccagatgagaaaaagccagagtgtggcagttgggatgttagccaccagccagagaccgct
gacacagcccatggtgttgagcgggagacaccccgggaggggacggcctttaacatctcc
tcctgggacaagaacgggagccccaacaaacagccatcctcggagcctgaatggactccc
gagccccggagctccagcagccagcacccggagcagacgggcaggacccggaggtcggga
cccatcaagaaaccagtcctgaaagccctcaaggtggaagacaaggagaaggagcttgag
aagattaagcaggagctaggggaggagagtacccggctggccaaggagaaggagcagagc
cccacggcagaaaaggatgaggacgaagagaacgatgcctctctggccaactcctccacc
accactttggaggacaaaggccctggccatgccacttttggccgcgaggccaccaaattt
gaagaggaggagaaacctgacaaggcctgggaagccagacccccacgagagtccagcgat
gttccccccatgaagagaaataactggatctttattgatgaggagcaagcctttggggtc
agaggacaggcccggggccggggccgtggtttcagagagttcacttttcgtggtcggcct
gctggcggaaatgggagcggcctctgtggtgggggggtcctgggggcccgcagcatctac
tgcagcagtcagcgcagcggccgtggccggggcctgcgagagtttgcgcggccagaggac
tgccccagagccaagccccgacggagagttgccagtgagacccatagcgagggctcagag
tatgaagaacttcccaagcgccgccggcagaggggctccgagaacgggaatgaaggctcg
ctcctggagagggaggagagcaccttgaagaagggcgactgcagagattcttggcggtcc
aacaaggggtgctctgaggaccacagcggtctagatgccaagagccgaggccctcgggcc
tttgggcgagccctccctccccggctgagcaattgcgggtatggacggagaaccttcgtc
tccaaagagtcaccccactggcagagcaaaagtccaggcagctcttggcaggaatatggc
ccttccgacacatgcggatcccggcgacctacagacagagactatgtcccagattcctac
agacaccctgacgcatttggtggccggggctttgaggacagccgcgcggaggacaagaga
tccttcttccaagatgaacacgtggcagattctgaaaatgcagagaaccggcccttcagg
agaaggcgccccccacgccaagataagccccctcgattccggcgcctccggcaagagcgg
gagtccctgggcctgtggggacccgaggaggagccccacctgctggcaggtcagtggcca
ggcaggcccaaactgtgttctggggacaagagtggcactgtgggccgcaggtcccctgag
ctctcctaccagaactcctccgatcacgccaatgaggagtgggagacggcctccgaaagc
agcgacttcagcgagcggcgggagcggcgggaaggccctgggtccgagcccgactcccag
gtggatggtggcctgtcgggggctagtttgggtgagaagaaggagctggccaagaggagc
ttctccagtcagagacccgtggttgacagacagagccgaaagctggagccgggagggttt
ggggagaagcccgttaggccaggtggtggtgacacctcccctcgctatgagagccaacag
aatgggacgcctttgaaagtgaaaagatccccagacgaggccttgcctggaggtcttagt
ggctgcagcagtgggagtggccactccccctatgccctggagcgggcagcccatgccagt
gctgaccttcccgaagcctccagtaaaaaggcagagaaggaggccaagttggctgctccg
agggcaggtgaacagggagaggccatgaaacagtttgacctgaactatggaagtgccatc
attgaaaattgcgggtccagccccggggaggagagtgaggtgggttctatggtgggcgaa
ggcttcatcgaagtcctgaccaagaagcagcgccgcctgctggaggaagagagaagaaag
aaggagcaggccgtgcaggtgcctgtcaaaggtcgaggcctttcctcccgtattcctcct
cgatttgcaaaaaagcagaacaacttatgtctggagcaaggtgacgtgaccgtgcctggc
agcagcctgggcactgagatctgggagagcagcagccaggctctccctgtgcaggcccca
gccaacgactcctggaggaaagctgtcactgccttcagcagcaccgagactggctctgcg
gagcagggttttaagagcagccagggagatagtggcgttgacttgagtgccgagtctcgg
gagtcgtctgcgacctcctcgcagcgcagctccccatatgggactctgaagccagaggag
atgagcgggcccggcctggcggaacccaaggccgacagccacaaggagcaggctccaaag
ccatctgagcagaaggattcagaacaaggctctggacagagcaaggagcacagaccagga
cccatcggcaacgagcgttctctgaaaaacagaaagggctcggagggggccgagcggctg
caaggggctgtcgtcccgcctgttaacggggtggagattcacgtggactccgtgctgcct
gtgccacccattgaatttggagtcagtccaaaagactccgatttcagcttgccacctggt
tctgcctctggtcctactgggagtccagttgttaaacttcaggatgccttggccagtaat
gcagggttaacacagagtatccccatcctgcggcgggaccatcacatccagagggccatc
ggtctctccccaatgtccttccccaccgccgaccttactctgaagatggagtctgcgcgc
aaggcttgggaaaactcccccagtttgccggagcagagctctccaggcggcgctggctca
ggcatccagcctccatcctctgtgggtgcctccagcggggtcaactacagctccttcggt
ggagtgtccatgccacccatgcctgtggcctctgtagcaccttctgcttctatgccaggc
agccacctcccgcccctgtacctggatggccatgtgtttgcaagtcagccccggctggtt
cctcaaacgatacctcagcagcagagttaccaacaggccgccgctgcccagcagatcccg
atctcccttcacacatctctgcaggcacaagctcagcttggactgaggggtgggcttcct
gtgtcccagtcccaggagatcttcagctccttgcagcccttcagatctcaggtgtacatg
caccccagcctgtcaccgcccagcaccatgatcctctctgggggcacagccttgaagcct
ccatactcggcgttcccaggcatgcagcccttggagatggtgaagccgcagtctggctca
ccctaccagcccatgagcgggaaccaagccctggtctacgagggccagctcagccaggct
gctggcctgggtgcctcccagatgttggactcccagctcccacagctgaccatgccactg
cctcggtacggctccgggcagcagccactgatcctgccccagtctattcagctgccacct
gggcagagcctctccgttggggccccccgaaggattcctccgcccgggtcccagccgcca
gtcctgaacaccagcagagagccctctcagatggagatgaaaggcttccactttgccgac
agtaaacagaatgtcccttcaggaggccccgtgccatcgccacagacctacaggcctagc
tctgctagccccagtgggaagccctctggatcagcagttaacatgggctctgtgcaggga
cactacgtgcaacaggcaaaacaacgagtggatgagaaacccagcctgggagccgtgaag
ctgcaggaggccccctcggctgcctcccagatgaagcgaaccggagcgatcaagcctcgg
gctgtcaaagtggaggagagtaaggcctga

DBGET integrated database retrieval system