KEGG   Homo sapiens (human): 84733Help
Entry
84733             CDS       T01001                                 

Gene name
CBX2, CDCA6, M33, SRXY5
Definition
(RefSeq) chromobox 2
  KO
K11451  chromobox protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84733 (CBX2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     84733 (CBX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Chromo CBX7_C Tudor-knot PI3K_1B_p101
Motif
Other DBs
NCBI-GeneID: 84733
NCBI-ProteinID: NP_005180
OMIM: 602770
HGNC: 1552
Ensembl: ENSG00000173894
Vega: OTTHUMG00000177463
Pharos: Q14781(Tbio)
UniProt: Q14781
Structure
PDB: 

Position
17q25.3
AA seq 532 aa AA seqDB search
MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQK
KEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSS
DEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKATRRPV
SLAKVLKTARKDLGAPASKLPPPLSAPVAGLAALKAHAKEACGGPSAMATPENLASLMKG
MASSPGRGGISWQSSIVHYMNRMTQSQAQAASRLALKAQATNKCGLGLDLKVRTQKGELG
MSPPGSKIPKAPSGGAVEQKVGNTGGPPHTHGASRVPAGCPGPQPAPTQELSLQVLDLQS
VKNGMPGVGLLARHATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVA
PPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTG
QNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctgagcagcgtgggcgagcaggtcttcgccgccgagtgcatcctgagcaag
cggctccgcaagggcaagctggagtacctggtcaagtggcgcggctggtcctccaaacat
aacagctgggagccggaggagaacatcctggacccgaggctgctcctggccttccagaag
aaggaacatgagaaggaggtgcagaaccggaagagaggcaagaggccgagaggccggcca
aggaagctcactgccatgtcctcctgcagccggcgctccaagctcaaggaacccgatgct
ccctccaaatccaagtccagcagttcctcctcttcctccacgtcatcctcctcttcctca
gatgaagaggatgacagtgacttagatgctaagaggggtccccggggccgcgagacccac
ccagtgccgcagaagaaggcccagatcctggtggccaaacccgagctgaaggatcccatc
cggaagaagcggggacgaaagcccctgcccccagagcaaaaggcaacccgaagacccgtg
agcctggccaaggtgctgaagaccgcccggaaggatctgggggccccggccagcaagctg
ccccctccactcagcgcccccgttgcaggcctggcagctctgaaggcccacgccaaggag
gcctgtggcggccccagtgccatggccaccccagagaacctggccagcctaatgaagggc
atggccagtagccccggccggggtggcatcagctggcagagctccatcgtgcactacatg
aaccggatgacccagagccaggcccaggctgccagcaggttggcgctgaaggcccaggcc
accaacaagtgcggcctcgggctggacctgaaggtgaggacgcagaaaggggagctggga
atgagccctccaggaagcaaaatcccgaaggcccccagcggtggggctgtggagcagaaa
gtggggaacacagggggccccccgcacacccatggtgccagcagggtgcctgctgggtgc
ccaggcccccagccagcacccacccaggagctgagcctccaggtcttggacttgcagagt
gtcaagaatggcatgcccggggtgggtctccttgcccgccacgccaccgccaccaagggt
gtcccggccaccaacccagcccctgggaagggcactgggagtggcctcattggggccagc
ggggccaccatgcccaccgacacaagcaaaagtgagaagctggcttccagagcagtggcg
ccacccacccctgccagcaagagggactgtgtcaagggcagtgctacccccagtgggcag
gagagccgcacagcccccggagaagcccgcaaggcggccacactgccagagatgagcgca
ggtgaggagagtagcagctcggactccgaccccgactccgcctcgccgcccagcactgga
cagaacccgtcagtgtccgttcagaccagccaggactggaagcccacccgcagcctcatc
gagcacgtatttgtcaccgacgtcactgccaacctcatcaccgtcacagtgaaggagtct
cccaccagcgtgggcttcttcaacctgaggcattactga

DBGET integrated database retrieval system