KEGG   Homo sapiens (human): 84734
Entry
84734             CDS       T01001                                 
Symbol
FAM167B, C1orf90, DIORA-2
Name
(RefSeq) family with sequence similarity 167 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM167 ATG16 DUF2388 DUF4530
Other DBs
NCBI-GeneID: 84734
NCBI-ProteinID: NP_116037
HGNC: 28133
Ensembl: ENSG00000183615
Pharos: Q9BTA0(Tdark)
UniProt: Q9BTA0
Position
1:32247222..32248856
AA seq 163 aa
MSLGLLKFQAVGEEDEEDEEGESLDSVKALTAKLQLQTRRPSYLEWTAQVQSQAWRRAQA
KPGPGGPGDICGFDSMDSALEWLRRELREMQAQDRQLAGQLLRLRAQLHRLKMDQACHLH
QELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtccctggggctactgaaattccaggcagtgggtgaagaggacgaggaggatgaggag
ggggagagcctggactctgtgaaggcactgacagccaagctgcagctgcagactcggcgg
ccctcatatctggagtggacagcccaggtccagagccaggcctggcgcagggcccaagcc
aaacctggaccagggggacctggggacatctgtggtttcgactcaatggactccgccctt
gagtggctccgacgggagctgcgggagatgcaggcgcaggacaggcagctggcagggcag
ctgctgcggctgcgggcccagctgcaccgactgaagatggaccaagcctgtcacctgcac
caggagctgctggatgaggccgagctggagctggagctggagcccggggccggcctagcc
ctggccccgctgctgcggcacctgggcctcacgcgcatgaacatcagcgcccggcgcttc
accctctgctga

DBGET integrated database retrieval system