KEGG   Homo sapiens (human): 84735Help
Entry
84735             CDS       T01001                                 

Gene name
CNDP1, CN1, CPGL2, HsT2308
Definition
(RefSeq) carnosine dipeptidase 1
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00410  beta-Alanine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    84735 (CNDP1)
   00340 Histidine metabolism
    84735 (CNDP1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    84735 (CNDP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84735 (CNDP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     84735 (CNDP1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M20
   84735 (CNDP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 WG_beta_rep
Motif
Other DBs
NCBI-GeneID: 84735
NCBI-ProteinID: NP_116038
OMIM: 609064
HGNC: 20675
Ensembl: ENSG00000150656
Vega: OTTHUMG00000132852
Pharos: Q96KN2(Tbio)
UniProt: Q96KN2
Structure
PDB: 

Position
18q22.3
AA seq 507 aa AA seqDB search
MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIE
SDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGS
DPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAF
RALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAIT
YGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVV
PLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPG
TKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIA
NIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQ
NEKINRWNYIEGTKLFAAFFLEMAQLH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaactcgggagaatggctgcgtccctgctggctgtgctgctgctgctgctg
gagcgcggcatgttctcctcaccctccccgcccccggcgctgttagagaaagtcttccag
tacattgacctccatcaggatgaatttgtgcagacgctgaaggagtgggtggccatcgag
agcgactctgtccagcctgtgcctcgcttcagacaagagctcttcagaatgatggccgtg
gctgcggacacgctgcagcgcctgggggcccgtgtggcctcggtggacatgggtcctcag
cagctgcccgatggtcagagtcttccaatacctcccgtcatcctggccgaactggggagc
gatcccacgaaaggcaccgtgtgcttctacggccacttggacgtgcagcctgctgaccgg
ggcgatgggtggctcacggacccctatgtgctgacggaggtagacgggaaactttatgga
cgaggagcgaccgacaacaaaggccctgtcttggcttggatcaatgctgtgagcgccttc
agagccctggagcaagatcttcctgtgaatatcaaattcatcattgaggggatggaagag
gctggctctgttgccctggaggaacttgtggaaaaagaaaaggaccgattcttctctggt
gtggactacattgtaatttcagataacctgtggatcagccaaaggaagccagcaatcact
tacggaacccgggggaacagctacttcatggtggaggtgaaatgcagagaccaggatttt
cactcaggaacctttggtggcatccttcatgaaccaatggctgatctggttgctcttctc
ggtagcctggtagactcgtctggtcatatcctggtccctggaatctatgatgaagtggtt
cctcttacagaagaggaaataaatacatacaaagccatccatctagacctagaagaatac
cggaatagcagccgggttgagaaatttctgttcgatactaaggaggagattctaatgcac
ctctggaggtacccatctctttctattcatgggatcgagggcgcgtttgatgagcctgga
actaaaacagtcatacctggccgagttataggaaaattttcaatccgtctagtccctcac
atgaatgtgtctgcggtggaaaaacaggtgacacgacatcttgaagatgtgttctccaaa
agaaatagttccaacaagatggttgtttccatgactctaggactacacccgtggattgca
aatattgatgacacccagtatctcgcagcaaaaagagcgatcagaacagtgtttggaaca
gaaccagatatgatccgggatggatccaccattccaattgccaaaatgttccaggagatc
gtccacaagagcgtggtgctaattccgctgggagctgttgatgatggagaacattcgcag
aatgagaaaatcaacaggtggaactacatagagggaaccaaattatttgctgcctttttc
ttagagatggcccagctccattaa

DBGET integrated database retrieval system