KEGG   Homo sapiens (human): 84750
Entry
84750             CDS       T01001                                 
Symbol
FUT10, FUCTX
Name
(RefSeq) fucosyltransferase 10
  KO
K09669  alpha-1,3-fucosyltransferase 10 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    84750 (FUT10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     84750 (FUT10)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   84750 (FUT10)
SSDB
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Other DBs
NCBI-GeneID: 84750
NCBI-ProteinID: NP_116053
OMIM: 616931
HGNC: 19234
Ensembl: ENSG00000172728
Pharos: Q6P4F1(Tdark)
UniProt: Q6P4F1
Position
8:complement(33308061..33473146)
AA seq 479 aa
MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLN
SFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTK
AFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLP
LTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEV
DSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLG
VVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEIS
NQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSC
PEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggtgcggattcagaggaggaagcttttggcatcttgcctgtgcgtcacagccaccgtc
tttctgcttgtcacactccaggtcatggttgagctggggaagtttgaaaggaaggagttt
aaaagttccagtttgcaagatggacatacaaaaatggaggaagcacctacgcatcttaat
tcatttcttaagaaagaaggattgaccttcaacaggaaaagaaaatgggaattggacagc
taccccattatgctctggtggtccccgctgacgggggagactgggaggttaggccaatgt
ggagcagatgcttgtttcttcaccatcaaccggacctacctccatcatcacatgaccaaa
gcattcctcttctatggtactgactttaacatagatagcttacctctgcctcggaaagcc
catcatgactgggctgtttttcatgaagagtccccgaaaaacaattataagctctttcat
aaaccagtgatcaccttgttcaactacactgccacgttcagcaggcattcccacttgcca
ctaactacccaatacttggagagcattgaagtcctgaagtcactccgatacctagttcct
ttgcagtccaaaaacaagcttagaaaaagacttgctccgctggtgtatgtacagtcagac
tgtgacccaccatcagacagggacagctatgttcgcgagctgatgacttacatcgaggtc
gattcctatggtgaatgtttacgaaacaaagacctccctcagcagctgaaaaatccagcc
tctatggatgccgatggcttttataggatcattgcacagtataagtttatcctagctttt
gagaatgcagtttgtgatgactacatcactgagaagttctggaggccactgaaactgggg
gtagtccctgtatattacggatcccccagcatcacagactggcttccaagtaacaaaagt
gctattcttgtatcagaattttctcaccccagggaactggcaagttacatcagacgactg
gattctgatgacagattgtatgaggcctatgtagaatggaagctgaagggtgagatctct
aaccagcgacttctgacagctctcagggaacggaaatggggagtgcaagacgtcaaccag
gacaattacatcgatgcatttgagtgtatggtgtgcaccaaggtgtgggctaatatcagg
cttcaggaaaagggcttaccacccaaaagatgggaggcagaagatacccacctgagttgc
ccagagcccacagtgtttgctttctcaccactccggactccacctttgagctctttgcga
gagatgtggatttccagctttgaacaatccaagaaagaagcccaggcactaaggtggctg
gttgataggaatcaaaacttttcatctcaagagttttggggcctagtattcaaggactga

DBGET integrated database retrieval system