KEGG   Homo sapiens (human): 84759
Entry
84759             CDS       T01001                                 
Symbol
PCGF1, 2010002K04Rik, NSPC1, RNF3A-2, RNF68
Name
(RefSeq) polycomb group ring finger 1
  KO
K11487  polycomb group RING finger protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    84759 (PCGF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84759 (PCGF1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     84759 (PCGF1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Rad60-SLD zf-RING_UBOX ATG8 zf-Nse Cobl zf-ANAPC11 zf-C3HC4_4 zf-RING_10
Other DBs
NCBI-GeneID: 84759
NCBI-ProteinID: NP_116062
OMIM: 610231
HGNC: 17615
Ensembl: ENSG00000115289
Vega: OTTHUMG00000129954
Pharos: Q9BSM1(Tbio)
UniProt: Q9BSM1
Structure
Position
2:complement(74505043..74507695)
AA seq 259 aa
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGK
DKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSR
WFGKPSPLLLQYSVKEKRR
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgtctcctcaggggggccagattgcgatcgcgatgaggcttcggaaccagctccag
tcagtgtacaagatggacccgctacggaacgaggaggaggttcgagtgaagatcaaagac
ttgaatgaacacattgtttgctgcctatgcgccggctacttcgtggatgccaccaccatc
acagagtgtcttcatactttctgcaagagttgtattgtgaagtacctccaaactagcaag
tactgccccatgtgcaacattaagatccacgagacacagccactgctcaacctcaaactg
gaccgggtcatgcaggacatcgtgtataagctggtgcctggcttgcaagacagtgaagag
aaacggattcgggaattctaccagtcccgaggtttggaccgggtcacccagcccactggg
gaagagccagcactgagcaacctcggcctccccttcagcagctttgaccactctaaagcc
cactactatcgctatgatgagcagttgaacctgtgcctggagcggctgagttctggcaaa
gacaagaataaaagcgtcctgcagaacaagtatgtccgatgttctgttagagctgaggta
cgccatctccggagggtcctgtgtcaccgcttgatgctaaaccctcagcatgtgcagctc
ctttttgacaatgaagttctccctgatcacatgacaatgaagcagatatggctctcccgc
tggttcggcaagccatcccctttgcttttacaatacagtgtgaaagagaagaggaggtag

DBGET integrated database retrieval system