KEGG   Homo sapiens (human): 8476Help
Entry
8476              CDS       T01001                                 

Gene name
CDC42BPA, MRCK, MRCKA, PK428
Definition
(RefSeq) CDC42 binding protein kinase alpha
  KO
K16307  serine/threonine-protein kinase MRCK [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8476 (CDC42BPA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8476 (CDC42BPA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   8476 (CDC42BPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase KELK Pkinase_Tyr DMPK_coil C1_1 Kinase-like Pkinase_C PBD PH
Motif
Other DBs
NCBI-GeneID: 8476
NCBI-ProteinID: NP_003598
OMIM: 603412
HGNC: 1737
Ensembl: ENSG00000143776
Vega: OTTHUMG00000037618
Pharos: Q5VT25(Tchem)
UniProt: Q5VT25
Position
1q42.13
AA seq 1719 aa AA seqDB search
MSGEVRLRQLEQFILDGPAQTNGQCFSVETLLDILICLYDECNNSPLRREKNILEYLEWA
KPFTSKVKQMRLHREDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPAQVTDVSENAKDLIRRLICSREHRLGQNGIEDFKKHPFFSGIDWDNIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPTSLDLDVNVQRTLDNNLATEAYERRIKRLEQEKLELSRKLQESTQTVQALQYSTVDGP
LTASKDLEIKNLKEEIEKLRKQVTESSHLEQQLEEANAVRQELDDAFRQIKAYEKQIKTL
QQEREDLNKELVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHV
RDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLREQSEHYSKQLE
NELEGLKQKQISYSPGVCSIEHQQEITKLKTDLEKKSIFYEEELSKREGIHANEIKNLKK
ELHDSEGQQLALNKEIMILKDKLEKTRRESQSEREEFESEFKQQYEREKVLLTEENKKLT
SELDKLTTLYENLSIHNQQLEEEVKDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEEL
NKVKASNIITECKLKDSEKKNLELLSEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTP
TDALDQFETVDSTPLSVHTPTLRKKGCPGSTGFPPKRKTHQFFVKSFTTPTKCHQCTSLM
VGLIRQGCSCEVCGFSCHITCVNKAPTTCPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPK
PAGVKKGWQRALAIVCDFKLFLYDIAEGKASQPSVVISQVIDMRDEEFSVSSVLASDVIH
ASRKDIPCIFRVTASQLSASNNKCSILMLADTENEKNKWVGVLSELHKILKKNKFRDRSV
YVPKEAYDSTLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIEL
IPNDQLVAVISGRNRHVRLFPMSALDGRETDFYKLSETKGCQTVTSGKVRHGALTCLCVA
MKRQVLCYELFQSKTRHRKFKEIQVPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGNPYS
MLHSNDHTLSFIAHQPMDAICAVEISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPS
SCCYNAPYLSVYSENAVDIFDVNSMEWIQTLPLKKVRPLNNEGSLNLLGLETIRLIYFKN
KMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISN
PTNFNHIAHMGPGDGIQILKDLPMNPRPQESRTVFSGSVSIPSITKSRPEPGRSMSASSG
LSARSSAQNGSALKREFSGGSYSAKRQPMPSPSEGSLSSGGMDQGSDAPARDFDGEDSDS
PRHSTASNSSNLSSPPSPASPRKTKSLSLESTDRGSWDP
NT seq 5160 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagaagtgcgtttgaggcagttggagcagtttattttggacgggcccgctcag
accaatgggcagtgcttcagtgtggagacattactggatatactcatctgcctttatgat
gaatgcaataattctccattgagaagagagaagaacattctcgaatacctagaatgggct
aaaccatttacttctaaagtgaaacaaatgcgattacatagagaagactttgaaatatta
aaggtgattggtcgaggagcttttggggaggttgctgtagtaaaactaaaaaatgcagat
aaagtgtttgccatgaaaatattgaataaatgggaaatgctgaaaagagctgagacagca
tgttttcgtgaagaaagggatgtattagtgaatggagacaataaatggattacaaccttg
cactatgctttccaggatgacaataacttatacctggttatggattattatgttggtggg
gatttgcttactctactcagcaaatttgaagatagattgcctgaagatatggctagattt
tacttggctgagatggtgatagcaattgactcagttcatcagctacattatgtacacaga
gacattaaacctgacaatatactgatggatatgaatggacatattcggttagcagatttt
ggttcttgtctgaagctgatggaagatggaacggttcagtcctcagtggctgtaggaact
ccagattatatctctcctgaaatccttcaagccatggaagatggaaaagggagatatgga
cctgaatgtgactggtggtctttgggggtctgtatgtatgaaatgctttacggagaaaca
ccattttatgcagaatcgctggtggagacatacggaaaaatcatgaaccacaaagagagg
tttcagtttccagcccaagtgactgatgtgtctgaaaatgctaaggatcttattcgaagg
ctcatttgtagcagagaacatcgacttggtcaaaatggaatagaagactttaagaaacac
ccatttttcagtggaattgattgggataatattcggaactgtgaagcaccttatattcca
gaagttagtagcccaacagatacatcgaattttgatgtagatgatgattgtttaaaaaat
tctgaaacgatgcccccaccaacacatactgcattttctggccaccatctgccatttgtt
ggttttacatatactagtagctgtgtactttctgatcggagctgtttaagagttacggct
ggtcccacctcactggatcttgatgttaatgttcagaggactctagacaacaacttagca
actgaagcttatgaaagaagaattaagcgccttgagcaagaaaaacttgaactcagtaga
aaacttcaagagtcaacacagactgtccaagctctgcagtattcaactgttgatggtcca
ctaacagcaagcaaagatttagaaataaaaaacttaaaagaagaaattgaaaaactaaga
aaacaagtaacagaatcaagtcatttggaacagcaacttgaagaagctaatgctgtgagg
caagaactagatgatgcttttagacaaatcaaggcttatgaaaaacaaatcaaaacgtta
caacaagaaagagaagatctaaataaggaactagtccaggctagtgagcgattaaaaaac
caatccaaagagctgaaagacgcacactgtcagaggaaactggccatgcaggaattcatg
gagatcaatgagcggctaacagaattgcacacccaaaaacagaaacttgctcgccatgtc
cgagataaggaagaagaggtggacctggtgatgcaaaaagttgaaagcttaaggcaagaa
ctgcgcagaacagaaagagccaaaaaagagctggaagttcatacagaagctctagctgct
gaagcatctaaagacaggaagctacgtgaacagagtgagcactattctaagcaactggaa
aatgaattggagggactgaagcaaaaacaaattagttactcaccaggagtatgcagcata
gaacatcagcaagagataaccaaactaaagactgatttggaaaagaaaagtatcttttat
gaagaagaattatctaaaagagaaggaatacatgcaaatgaaataaaaaatcttaagaaa
gaactgcatgattcagaaggtcagcaacttgctctcaacaaagaaattatgattttaaaa
gacaaattggaaaaaaccagaagagaaagtcaaagtgaaagggaggaatttgaaagtgag
ttcaaacaacaatatgaacgagaaaaagtgttgttaactgaagaaaataaaaagctgacg
agtgaacttgataagcttactactttgtatgagaacttaagtatacacaaccagcagtta
gaagaagaggttaaagatctagcagacaagaaagaatcagttgcacattgggaagcccaa
atcacagaaataattcagtgggtcagcgatgaaaaggatgcacgagggtatcttcaggcc
ttagcttctaaaatgactgaagaattggaggcattaagaaattccagcttgggtacacga
gcaacagatatgccctggaaaatgcgtcgttttgcgaaactggatatgtcagctagactg
gagttgcagtcggctctggatgcagaaataagagccaaacaggccatccaagaagagttg
aataaagttaaagcatctaatatcataacagaatgtaaactaaaagattcagagaagaag
aacttggaactactctcagaaatcgaacagctgataaaggacactgaagagcttagatct
gaaaagggtatagagcaccaagactcacagcattctttcttggcatttttgaatacgcct
accgatgctctggatcaatttgaaactgtagactccactccactttcagttcacacacca
accttaaggaaaaaaggatgtcctggttcaactggctttccacctaagcgcaagactcac
cagttttttgtaaaatcttttactactcctaccaagtgtcatcagtgtacctccttgatg
gtgggtttaataagacagggctgttcatgtgaagtgtgtggattctcatgccatataact
tgtgtaaacaaagctccaaccacttgtccagttcctcctgaacagacaaaaggtcccctg
ggtatagatcctcagaaaggaataggaacagcatatgaaggtcatgtcaggattcctaag
ccagctggagtgaagaaagggtggcagagagcactggctatagtgtgtgacttcaaactc
tttctgtacgatattgctgaaggaaaagcatctcagcccagtgttgtcattagtcaagtg
attgacatgagggatgaagaattttctgtgagttcagtcttggcttctgatgttatccat
gcaagtcggaaagatataccctgtatatttagggtcacagcttcccagctctcagcatct
aataacaaatgttcaatcctgatgctagcagacactgagaatgagaagaataagtgggtg
ggagtgctgagtgaattgcacaagattttgaagaaaaacaaattcagagaccgctcagtc
tatgttcccaaagaggcttatgacagcactctacccctcattaaaacaacccaggcagcc
gcaatcatagatcatgaaagaattgctttgggaaacgaagaagggttatttgttgtacat
gtcaccaaagatgaaattattagagttggtgacaataagaagattcatcagattgaactc
attccaaatgatcagcttgttgctgtgatctcaggacgaaatcgtcatgtacgacttttt
cctatgtcagcattggatgggcgagagaccgatttttacaagctgtcagaaactaaaggg
tgtcaaaccgtaacttctggaaaggtgcgccatggagctctcacatgcctgtgtgtggct
atgaaaaggcaggtcctctgttatgaactatttcagagcaagacccgtcacagaaaattt
aaagaaattcaagtcccatataatgtccagtggatggcaatcttcagtgaacaactctgt
gtgggattccagtcaggatttctaagataccccttgaatggagaaggaaatccatacagt
atgctccattcaaatgaccatacactatcatttattgcacatcaaccaatggatgctatc
tgcgcagttgagatctccagtaaagaatatctgctgtgttttaacagcattgggatatac
actgactgccagggccgaagatctagacaacaggaattgatgtggccagcaaatccttcc
tcttgttgttacaatgcaccatatctctcggtgtacagtgaaaatgcagttgatatcttt
gatgtgaactccatggaatggattcagactcttcctctcaaaaaggttcgacccttaaac
aatgaaggatcattaaatcttttagggttggagaccattagattaatatatttcaaaaat
aagatggcagaaggggacgaactggtagtacctgaaacatcagataatagtcggaaacaa
atggttagaaacattaacaataagcggcgttattccttcagagtcccagaagaggaaagg
atgcagcagaggagggaaatgctacgagatccagaaatgagaaataaattaatttctaat
ccaactaattttaatcacatagcacacatgggtcctggagatggaatacagatcctgaaa
gatctgcccatgaaccctcggcctcaggaaagtcggacagtattcagtggctcagtcagt
attccatctatcaccaaatcccgccctgagccaggccgctccatgagtgctagcagtggc
ttgtcagcaaggtcatccgcacagaatggcagcgcattaaagagggaattctctggagga
agctacagtgccaagcggcagcccatgccctccccgtcagagggctctttgtcctctgga
ggcatggaccaaggaagtgatgccccagcgagggactttgacggagaggactctgactct
ccgaggcattccacagcttccaacagttccaacctaagcagccccccaagcccagcttca
ccccgaaaaaccaagagcctctccctggagagcactgaccgcgggagctgggacccgtga

DBGET integrated database retrieval system