KEGG   Homo sapiens (human): 84765
Entry
84765             CDS       T01001                                 

Gene name
ZNF577
Definition
(RefSeq) zinc finger protein 577
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    84765 (ZNF577)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    84765 (ZNF577)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    84765 (ZNF577)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zinc_ribbon_15 C1_1 zf-met C1_4 Siva CtsR Hydrophobin_2 DUF3268
Other DBs
NCBI-GeneID: 84765
NCBI-ProteinID: NP_116068
HGNC: 28673
Ensembl: ENSG00000161551
Pharos: Q9BSK1(Tdark)
UniProt: Q9BSK1 A0A024R4N6
Position
19q13.41
AA seq 485 aa
MKNATIVMSVRREQGSSSGEGSLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYINLV
SIGYRGTKPDSLFKLEQGEPPGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLH
IKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTE
RGEKPHGCGECGKTFMRKIQLTEHQRTHTGEKPHECSECGKAFSRKSQLMVHQRTHTGEK
PYRCSKCGKAFSRKCRLNRHQRSHTGEKLYGCSVCGKAFSQKAYLTAHQRLHTGDKPYKC
SDCGRTFYFKSDLTRHQRIHTGEKPYECSECEKAFRSKSKLIQHQRTHTGERPYSCRECG
KAFAHMSVLIKHEKTHIRETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSS
GTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSVINYILYLT
DIVSE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaaaaatgccacgattgtaatgtctgtgaggagagagcaaggcagttcttcaggggag
gggtcattgtcattcgaagatgtggctgtgggcttcaccagggaggagtggcagtttttg
gaccagtctcagaaggtcttgtacaaggaagtaatgttggagaactacatcaacctagta
tcaatagggtatcgaggcaccaagccagattcgctcttcaagttggagcaaggagaaccc
ccagggatagcagaaggagcagcccacagtcaaatctgtccaggttttgtaatccagagt
agaagatatgcaggaaaagattctgatgcatttggtggatatgggagatcatgcctccat
atcaagcgtgacaaaactcttactggagttaaataccatagatgtgttaaacccagcagc
cctaaatcacagctcaatgacctacaaaaaatttgtgcaggagggaaaccacatgaatgc
agtgtgtgcgggagagccttctccaggaaagcacagcttattcaacatcagagaactgaa
agaggagagaaaccccatggatgtggtgaatgtgggaaaacattcatgaggaagattcag
ctcactgagcatcagagaactcacacaggagagaagccccatgaatgtagtgaatgtgga
aaagccttctccagaaagtcacagctcatggtccatcagagaacccatacaggagagaaa
ccctacagatgcagcaaatgcggaaaagccttcagccggaagtgccggctcaatagacat
cagcgatcacatactggagagaaactctatgggtgcagtgtgtgtgggaaagccttttct
cagaaggcatacctcactgcacaccagagacttcacacaggagataagccttataaatgc
agtgattgtggaagaaccttctattttaagtcagacctgaccagacatcagaggattcat
acgggagagaaaccttatgaatgtagtgagtgtgaaaaagcctttagaagcaagtcgaag
ctcattcagcatcagcgtactcacactggagagagaccatattcatgcagagaatgtggc
aaagcctttgcccacatgtcagtcctcattaaacatgagaaaactcacataagagagaca
gccataaattcactgacggtggagaaaccttcctcaaggagtcatacctccttatacatg
agcgaactcatacaagagcaaaagactgtgaacacagtacctatagaaatgccttcctca
ggaaccccgccattgttaaacaagagtgagcgcctagtgggcagaaatgtagtgattgtg
gaacaaccttttccaagaaatcaagcctttgtagttaatcaggaatttgaacagagaata
agcctcacaaatgaagtgaatgtggccccatcagtaataaattatatcttgtatcttaca
gatattgtatcagaataa

DBGET integrated database retrieval system