KEGG   Homo sapiens (human): 84766
Entry
84766             CDS       T01001                                 
Symbol
CRACR2A, EFCAB4B, RAB46
Name
(RefSeq) calcium release activated channel regulator 2A
  KO
K17199  Ras and EF-hand domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    84766 (CRACR2A)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    84766 (CRACR2A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab45
    84766 (CRACR2A)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   84766 (CRACR2A)
SSDB
Motif
Pfam: Ras Roc Arf EF-hand_7 EF-hand_6 EF-hand_1 MMR_HSR1 EF-hand_5 EF-hand_8 Gtr1_RagA AAA_33 Crescentin GTP_EFTU
Other DBs
NCBI-GeneID: 84766
NCBI-ProteinID: NP_001138430
OMIM: 614178
HGNC: 28657
Ensembl: ENSG00000130038
Pharos: Q9BSW2(Tbio)
UniProt: Q9BSW2
Structure
Position
12:complement(3615328..3753109)
AA seq 731 aa
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQ
TCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
NNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVK
QLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEM
EQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHE
TKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQR
EKAGLLKQLDFLRERNKHLRDERDICFQKNKAAKANTAASRASWKKRSGSVIGKYVDSRG
ILRSQSEEEEEVFGIPRRSSLGLSGYPLTEEEPGTGEPGPGGPYPRPLRRIISVEEDPLP
QLLDGGFEQPLSKCSEEEEVSDQGVQGQIPEAPPLKLTPTSPRGQPVGKEALCKEESSPS
APDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWD
TAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKL
DNEKEREVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQV
GHPAKKKSCCG
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggctgcccctgacgggagggtagtctccagaccccagagacttggtcaggggtctggc
caggggccaaaggggagtggagcctgcctgcatcccctggacagcctggagcagaaggag
actcaggagcaaacgtcgggccagctagtcatgctgaggaaggcacaggagttctttcag
acctgtgatgctgaaggcaagggcttcatcgccaggaaggatatgcagaggctgcataag
gagctaccgctcagcctggaggaactggaggatgtgtttgatgccctggatgctgatggc
aatggctatctgaccccacaggagttcactactggatttagtcacttcttcttcagccag
aataacccaagtcaggaagatgcaggtgaacaggtggcccagcgccatgaagagaaggtg
tatctgtccagaggggatgaggatctgggcgacatgggcgaagatgaggaagcccagttc
cggatgctgatggacagacttggagcccaaaaggtgttggaagatgaaagtgatgtcaag
cagctctggttgcagctgaagaaggaggaacctcatttactgtccaactttgaagacttc
ctgaccagaatcatctcccagctccaagaagcccatgaggagaagaatgaactggagtgt
gccctaaaaaggaaaattgctgcttatgatgaagaaatccagcatctctatgaggagatg
gaacaacaaatcaaaagtgagaaggagcagtttctcctgaaggacacagagaggtttcaa
gcccgcagtcaagagctggagcagaaactgttatgtaaggagcaggagctggagcagctc
acccagaagcagaaaaggctggaaggtcagtgcacagccctgcatcatgacaagcatgag
accaaggctgagaataccaagctgaaactcactaaccaggagctggcccgggagctggag
cggacttcctgggagctccaggatgctcagcagcagttggaaagcctccagcaagaggcc
tgcaaactccaccaagagaaggagatggaagtgtaccgtgtgacggagagtctacagcgt
gagaaggccgggctcctcaagcagctggatttcctaagggaaaggaacaagcaccttcgg
gatgaacgggacatatgttttcagaaaaataaggcagccaaggcaaacacagctgcttcc
agggcaagttggaaaaagagatctggctctgtgataggcaaatatgtggacagcagaggg
attcttaggagccagtcagaggaggaggaggaggtgtttggcatcccaaggagaagctcc
ctgggcctgagtggatatcccctaacagaagaggagccaggaaccggggagccagggcct
gggggtccgtacccccggccgctccgcagaatcatctccgttgaagaagaccccctgccc
cagctcctggatggtggctttgagcaacccctgagcaaatgctcagaagaggaagaggtc
tctgaccagggggtacagggacaaatcccggaggccccacccttgaaactcacccccaca
tccccccgagggcagcctgttggaaaagaagccctgtgtaaggaggaaagctctccctct
gcccctgaccggctcttcaagattgtgttcgtgggcaattccgcggtggggaagacatcc
ttcctgaggagattctgtgaggaccggttctccccaggcatggcggccactgtgggcatt
gattaccgtgtgaagacgttgaatgtggacaactctcaggtggccctgcagctgtgggac
acggctgggcaggagaggtaccggtgcatcacccagcagttcttcagaaaggcagatggt
gtcatcgtcatgtacgatctcacagacaagcagtcgttcctgtcggtccggcggtggctg
agcagcgtggaggaagctgtgggagaccgggtgcctgttcttctgctgggtaataagctt
gacaacgagaaggagcgggaagtcccccggggcctcggagagcagcttgccacggagaac
aatctgatcttctatgaatgcagcgcctactctggtcacaacaccaaagagtccctgctc
catctggccaggttcctcaaggagcaagaagacacagtgagagaggacaccattcaggtc
ggccaccctgctaagaagaaatcctgctgtggctga

DBGET integrated database retrieval system