KEGG   Homo sapiens (human): 8477
Entry
8477              CDS       T01001                                 

Gene name
GPR65, TDAG8, hTDAG8
Definition
(RefSeq) G protein-coupled receptor 65
  KO
K08416  psychosine receptor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8477 (GPR65)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    8477 (GPR65)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 8477
NCBI-ProteinID: NP_003599
OMIM: 604620
HGNC: 4517
Ensembl: ENSG00000140030
Vega: OTTHUMG00000028648
Pharos: Q8IYL9(Tbio)
UniProt: Q8IYL9 B5B0C2
Position
14q31.3
AA seq 337 aa
MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSD
LLYALTLPLWIDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPL
KFFFLRTRRFALMVSLSIWILETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQ
INLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRIIKLLVSITVTFVLCFT
PFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYD
MWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaacagcacatgtattgaagaacagcatgacctggatcactatttgtttcccattgtt
tacatctttgtgattatagtcagcattccagccaatattggatctctgtgtgtgtctttc
ctgcaagcaaagaaggaaagtgaactaggaatttacctcttcagtttgtcactatcagat
ttactctatgcattaactctccctttatggattgattatacctggaataaagacaactgg
actttctctcctgccttgtgcaaagggagtgcttttctcatgtacatgaatttttacagc
agcacagcattcctcacctgcattgccgttgatcggtatttggctgttgtctaccctttg
aagttttttttcctaaggacaagaagatttgcactcatggtcagcctgtccatctggata
ttggaaaccatcttcaatgctgtcatgttgtgggaagatgaaacagttgttgaatattgc
gatgccgaaaagtctaattttactttatgctatgacaaataccctttagagaaatggcaa
atcaacctcaacttgttcaggacgtgtacaggctatgcaatacctttggtcaccatcctg
atctgcaaccggaaagtctaccaagctgtgcggcacaataaagccacggaaaacaaggaa
aagaagagaatcataaaactacttgtcagcatcacagttacttttgtcttatgctttact
ccctttcatgtgatgttgctgattcgctgcattttagagcatgctgtgaacttcgaagac
cacagcaattctgggaagcgaacttacacaatgtatagaatcacggttgcattaacaagt
ttaaattgtgttgctgatccaattctgtactgttttgtaaccgaaacaggaagatatgat
atgtggaatatattaaaattctgcactgggaggtgtaatacatcacaaagacaaagaaaa
cgcatactttctgtgtctacaaaagatactatggaattagaggtccttgagtag

DBGET integrated database retrieval system