KEGG   Homo sapiens (human): 84779
Entry
84779             CDS       T01001                                 
Symbol
NAA11, ARD1B, ARD2, hARD2
Name
(RefSeq) N-alpha-acetyltransferase 11, NatA catalytic subunit
  KO
K20791  N-alpha-acetyltransferase 10/11 [EC:2.3.1.255]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84779 (NAA11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.255  N-terminal amino-acid Nalpha-acetyltransferase NatA
     84779 (NAA11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    84779 (NAA11)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_9 Acetyltransf_15 Acetyltransf_13 FeeM Acetyltransf_3
Other DBs
NCBI-GeneID: 84779
NCBI-ProteinID: NP_116082
OMIM: 619432
HGNC: 28125
Ensembl: ENSG00000156269
UniProt: Q9BSU3
Position
4:complement(79155376..79326061)
AA seq 229 aa
MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEEPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRPALH
LYSNTLNFQISEVEPKYYADGEDAYAMKRDLSQMADELRRQMDLKKGGYVVLGSRENQET
QGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSESSDSTS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaacatccgcaacgctcagccagacgacctgatgaatatgcaacactgcaacctcctt
tgccttcctgagaactaccagatgaaatactatttatatcatggcctttcctggccccag
ctttcttacatcgctgaggatgaggacgggaagattgtgggctatgttctggccaaaatg
gaggaggaaccagatgatgtcccgcatggccatatcacctcactggccgtgaagcgttca
caccggcgcctcggcctggcccagaagctgatggaccaggcctccagggccatgatagag
aactttaacgccaaatacgtgtctctgcacgtcaggaagagtaaccggccagccttgcac
ctttattctaacaccctcaactttcagattagtgaggtggaacctaaatactatgcagat
ggggaagatgcttatgctatgaagcgggatctctcgcagatggcagatgagctgagacga
caaatggacctgaagaagggcgggtatgtggtcctgggctccagggagaaccaggagacc
cagggcagcacactttctgattctgaagaggcctgtcagcaaaagaacccggctaccgaa
gaaagtggcagtgacagcaaagaacctaaggagtctgtggagagcaccaacgtccaggac
agctcagaaagctcggattccacctcctag

DBGET integrated database retrieval system