KEGG   Homo sapiens (human): 84803Help
Entry
84803             CDS       T01001                                 

Gene name
GPAT3, AGPAT_10, AGPAT10, AGPAT8, AGPAT9, HMFN0839, LPAAT-theta, MAG1
Definition
(RefSeq) glycerol-3-phosphate acyltransferase 3
  KO
K13506  glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    84803 (GPAT3)
   00564 Glycerophospholipid metabolism
    84803 (GPAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     84803 (GPAT3)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  GPAT
   84803 (GPAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 84803
NCBI-ProteinID: NP_001243350
OMIM: 610958
HGNC: 28157
Ensembl: ENSG00000138678
Vega: OTTHUMG00000130431
Pharos: Q53EU6(Tbio)
UniProt: Q53EU6 A0A024RDG5
Position
4q21.23
AA seq 434 aa AA seqDB search
MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE
SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE
LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ
LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT
DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI
FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW
AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ
KNYSKMIVGNGSLS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcagagctggccgggaagatcctttccacctggctgacgctggttctcggc
ttcatccttttaccttcggtcttcggagtgtctctgggcatctccgagatctacatgaag
atcctagtgaaaactttagagtgggccacaatacgaattgaaaaaggaaccccaaaggag
tcgattcttaaaaactctgcttctgttggtattatccaaagagatgagtcacccatggaa
aaagggctctctggtctacgaggaagggactttgagctgtctgacgtgttttatttctcc
aagaagggattggaagccattgtagaagatgaagtgacccagaggttttcctcagaggag
ctagtgtcatggaatctcctcacaagaaccaatgtaaatttccagtacatcagtctgcgg
ctcactatggtgtgggtgctgggcgtcatagtgcgctattgtgtcctactgcctctgagg
gttaccttggctttcattgggatcagtttgctggttataggaactacactggttgggcag
ctgccagacagcagcctcaaaaactggctgagtgaactggtccatctgacttgctgccgg
atctgtgtgcgagccctctctggtaccattcattatcataacaagcagtacagaccccag
aagggaggcatttgtgttgccaaccatacttcccccattgatgttttaatcttgacaacg
gatggatgttatgctatggttggccaggttcatggcggcttgatgggaattattcagaga
gctatggtcaaggcttgtcctcatgtctggtttgaacgctcagaaatgaaggatcgacac
ctggttactaagagactaaaagaacatattgctgataagaagaaactacccatactaatt
tttcctgaaggaacttgcatcaacaatacttcagtcatgatgtttaaaaaggggagcttt
gaaattggaggaaccatacatccagttgcaattaagtataaccctcagttcggtgatgca
ttttggaacagtagtaaatacaacatggtgagctacctgcttcgaatgatgaccagctgg
gccatcgtctgtgacgtgtggtacatgccccccatgaccagagaggaaggagaagatgca
gtccagtttgctaacagggttaagtctgctattgctatacaaggaggcctgactgaactt
ccctgggatggaggactaaagagagcaaaggtgaaggacatctttaaggaagagcagcag
aaaaattacagcaagatgattgtgggcaatggatctctcagctaa

DBGET integrated database retrieval system