KEGG   Homo sapiens (human): 84812
Entry
84812             CDS       T01001                                 
Symbol
PLCD4
Name
(RefSeq) phospholipase C delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04020  Calcium signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05131  Shigellosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    84812 (PLCD4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    84812 (PLCD4)
   04070 Phosphatidylinositol signaling system
    84812 (PLCD4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84812 (PLCD4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    84812 (PLCD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    84812 (PLCD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84812 (PLCD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     84812 (PLCD4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    84812 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    84812 (PLCD4)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 PH GDPD PH_12 EF-hand_8 Wap1 SBP_bac_5
Other DBs
NCBI-GeneID: 84812
NCBI-ProteinID: NP_116115
OMIM: 605939
HGNC: 9062
Ensembl: ENSG00000115556
Vega: OTTHUMG00000154743
Pharos: Q9BRC7(Tbio)
UniProt: Q9BRC7
Position
2:218607899..218637175
AA seq 762 aa
MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPS
FSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQ
LLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLHLMNVEMDQEYAFSLFQ
AADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDC
TSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF
ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGHTLTSRILF
KDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLTEILGEQLLSTTLDGVLPTQL
PSPEELRRKILVKGKKLTLEEDLEYEEEEAEPELEESELALESQFETEPEPQEQNLQNKD
KKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFV
QHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG
YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIF
GVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTL
PWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES
NT seq 2289 nt   +upstreamnt  +downstreamnt
atggcgtccctgctgcaagaccagctgaccactgatcaggacttgctgctgatgcaggaa
ggcatgccgatgcgcaaggtgaggtccaaaagctggaagaagctaagatacttcagactt
cagaatgacggcatgacagtctggcatgcacggcaggccaggggcagtgccaagcccagc
ttctcaatctctgatgtggagacaatacgtaatggccatgattccgagttgctgcgtagc
ctggcagaggagctccccctggagcagggcttcaccattgtcttccatggccgccgctcc
aacctggacctgatggccaacagtgttgaggaggcccagatatggatgcgagggctccag
ctgttggtggatcttgtcaccagcatggaccatcaggagcgcctggaccaatggctgagc
gattggtttcaacgtggagacaaaaatcaggatggtaagatgagtttccaagaagttcag
cggttattgcacctaatgaatgtggaaatggaccaagaatatgccttcagtctttttcag
gcagcagacacgtcccagtctggaaccctggaaggagaagaattcgtacagttctataag
gcattgactaaacgtgctgaggtgcaggaactgtttgaaagtttttcagctgatgggcag
aagctgactctgctggaatttttggatttcctccaagaggagcagaaggagagagactgc
acctctgagcttgctctggaactcattgaccgctatgaaccttcagacagtggcaaactg
cggcatgtgctgagtatggatggcttcctcagctacctctgctctaaggatggagacatc
ttcaacccagcctgcctccccatctatcaggatatgactcaacccctgaaccactacttc
atctgctcttctcataacacctacctagtgggggaccagctttgtggccagagcagcgtc
gagggatatatacgggccctgaagcgggggtgccgctgcgtggaggtggatgtatgggat
ggacctagcggggaacctgtcgtttaccacggacacaccctgacctcccgcatcctgttc
aaagatgtcgtggccacagtagcacagtatgccttccagacatcagactacccagtcatc
ttgtccctggagacccactgcagctgggagcagcagcagaccatggcccgtcatctgact
gagatcctgggggagcagctgctgagcaccaccttggatggggtgctgcccactcagctg
ccctcgcctgaggagcttcggaggaagatcctggtgaaggggaagaagttaacacttgag
gaagacctggaatatgaggaagaggaagcagaacctgagttggaagagtcagaattggcg
ctggagtcccagtttgagactgagcctgagccccaggagcagaaccttcagaataaggac
aaaaagaagaaatccaagcccatcttgtgtccagccctctcttccctggttatctacttg
aagtctgtctcattccgcagcttcacacattcaaaggagcactaccacttctacgagata
tcatctttctctgaaaccaaggccaagcgcctcatcaaggaggctggcaatgagtttgtg
cagcacaatacttggcagttaagccgtgtgtatcccagcggcctgaggacagactcttcc
aactacaacccccaggaactctggaatgcaggctgccagatggtggccatgaatatgcag
actgcagggcttgaaatggacatctgtgatgggcatttccgccagaatggcggctgtggc
tatgtgctgaagccagacttcctgcgtgatatccagagttctttccaccctgagaagccc
atcagccctttcaaagcccagactctcttaatccaggtgatcagcggtcagcaactcccc
aaagtggacaagaccaaagaggggtccattgtggatccactggtgaaagtgcagatcttt
ggcgttcgtctagacacagcacggcaggagaccaactatgtggagaacaatggttttaat
ccatactgggggcagacactatgtttccgggtgctggtgcctgaacttgccatgctgcgt
tttgtggtaatggattatgactggaaatcccgaaatgactttattggtcagtacaccctg
ccttggacctgcatgcaacaaggttaccgccacattcacctgctgtccaaagatggcatc
agcctccgcccagcttccatctttgtgtatatctgcatccaggaaggcctggagggggat
gagtcctga

DBGET integrated database retrieval system