KEGG   Homo sapiens (human): 84816Help
Entry
84816             CDS       T01001                                 

Gene name
RTN4IP1, NIMP, OPA10
Definition
(RefSeq) reticulon 4 interacting protein 1
Organism
hsa  Homo sapiens (human)
Disease
H01020  Optic atrophy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N THF_DHG_CYH_C Methyltransf_24 Semialdhyde_dh ELFV_dehydrog Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 84816
NCBI-ProteinID: NP_116119
OMIM: 610502
HGNC: 18647
Ensembl: ENSG00000130347
Vega: OTTHUMG00000015304
Pharos: Q8WWV3(Tbio)
UniProt: Q8WWV3
Structure
PDB: 

Position
6q21
AA seq 396 aa AA seqDB search
MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFT
QNMMMPIIHYPNEVIVKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLG
RDVSGVVMECGLDVKYFKPGDEVWAAVPPWKQGTLSEFVVVSGNEVSHKPKSLTHTQAAS
LPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCSQDA
SELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTL
VTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAG
KIRPVIEQTFPFSKVPEAFLKVERGHARGKTVINVV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggaatttctgaagacttgtgtacttagaagaaatgcatgcactgcggtttgcttctgg
agaagcaaagttgtccaaaagccttcagttagaaggattagtactacctctcctaggagc
actgtcatgcctgcttgggtgatagataaatatgggaagaatgaagtgcttcgattcact
cagaacatgatgatgcctatcatacactatccaaatgaagtcattgtcaaagttcacgct
gccagtgtaaatcctatagacgttaatatgagaagtggttatggagctacagctttaaat
atgaagcgtgatcctttacacgtgaaaatcaaaggagaagaatttcctctgactctgggt
cgggatgtctctggcgtggtgatggaatgtgggcttgatgtgaaatacttcaagcctgga
gatgaggtctgggctgcagttcctccttggaaacaaggcactctttcagagtttgttgta
gtcagtgggaatgaggtctctcacaaacccaaatcactcactcatactcaagctgcctct
ttgccatatgtggctctcacagcctggtctgctataaacaaagttggtggcctgaatgac
aagaattgcacaggaaaacgtgttctaatcttaggcgcttcaggcggagttggtactttt
gctatacaggtaatgaaagcatgggatgctcatgtgacagcagtttgctcccaagatgcc
agtgaacttgtaaggaagcttggtgcagacgatgtaattgattacaaatctggaagtgtg
gaagagcagttgaaatccttaaaaccatttgattttatccttgataatgttggcggatcc
actgaaacatgggctccagattttctcaagaaatggtcaggagccacctatgtgactttg
gtgactcctttcctcctgaacatggaccgattgggcatagcagatggcatgttgcagaca
ggagtcactgtaggttcaaaggcattaaagcatttctggaaaggagtccattatcgctgg
gcatttttcatggccagtggcccatgtttagatgacattgcagaactggtggatgcggga
aagatccggccagttattgaacaaacctttcctttttctaaagttccagaagccttcctg
aaggtggaaagaggacacgcacgaggaaagactgtaattaatgttgtttaa

DBGET integrated database retrieval system