KEGG   Homo sapiens (human): 8482Help
Entry
8482              CDS       T01001                                 

Gene name
SEMA7A, CD108, CDw108, H-SEMA-K1, H-Sema-L, JMH, SEMAK1, SEMAL
Definition
(RefSeq) semaphorin 7A (John Milton Hagen blood group)
  KO
K06529  semaphorin 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    8482 (SEMA7A)
CD molecules [BR:hsa04090]
 Proteins
  8482 (SEMA7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema Ig_2 PSI Ig_3 V-set
Motif
Other DBs
NCBI-GeneID: 8482
NCBI-ProteinID: NP_003603
OMIM: 607961
HGNC: 10741
Ensembl: ENSG00000138623
Vega: OTTHUMG00000139000
Pharos: O75326(Tbio)
UniProt: O75326 B3KMH6
Structure
PDB: 

Position
15q24.1
AA seq 666 aa AA seqDB search
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSC
LDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLV
LFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKI
YYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNF
NRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPN
PRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVS
SQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKE
CPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFI
ENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLT
LGLLVH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctcctccgcccggacgtgccgcccccagcgcaccgcgcgcccgcgtccctggc
ccgccggctcggttggggcttccgctgcggctgcggctgctgctgctgctctgggcggcc
gccgcctccgcccagggccacctaaggagcggaccccgcatcttcgccgtctggaaaggc
catgtagggcaggaccgggtggactttggccagactgagccgcacacggtgcttttccac
gagccaggcagctcctctgtgtgggtgggaggacgtggcaaggtctacctctttgacttc
cccgagggcaagaacgcatctgtgcgcacggtgaatatcggctccacaaaggggtcctgt
ctggataagcgggactgcgagaactacatcactctcctggagaggcggagtgaggggctg
ctggcctgtggcaccaacgcccggcaccccagctgctggaacctggtgaatggcactgtg
gtgccacttggcgagatgagaggctacgcccccttcagcccggacgagaactccctggtt
ctgtttgaaggggacgaggtgtattccaccatccggaagcaggaatacaatgggaagatc
cctcggttccgccgcatccggggcgagagtgagctgtacaccagtgatactgtcatgcag
aacccacagttcatcaaagccaccatcgtgcaccaagaccaggcttacgatgacaagatc
tactacttcttccgagaggacaatcctgacaagaatcctgaggctcctctcaatgtgtcc
cgtgtggcccagttgtgcaggggggaccagggtggggaaagttcactgtcagtctccaag
tggaacacttttctgaaagccatgctggtatgcagtgatgctgccaccaacaagaacttc
aacaggctgcaagacgtcttcctgctccctgaccccagcggccagtggagggacaccagg
gtctatggtgttttctccaacccctggaactactcagccgtctgtgtgtattccctcggt
gacattgacaaggtcttccgtacctcctcactcaagggctaccactcaagccttcccaac
ccgcggcctggcaagtgcctcccagaccagcagccgatacccacagagaccttccaggtg
gctgaccgtcacccagaggtggcgcagagggtggagcccatggggcctctgaagacgcca
ttgttccactctaaataccactaccagaaagtggccgtccaccgcatgcaagccagccac
ggggagacctttcatgtgctttacctaactacagacaggggcactatccacaaggtggtg
gaaccgggggagcaggagcacagcttcgccttcaacatcatggagatccagcccttccgc
cgcgcggctgccatccagaccatgtcgctggatgctgagcggaggaagctgtatgtgagc
tcccagtgggaggtgagccaggtgcccctggacctgtgtgaggtctatggcgggggctgc
cacggttgcctcatgtcccgagacccctactgcggctgggaccaaggccgctgcatctcc
atctacagctccgaacggtcagtgctgcaatccattaatccagccgagccacacaaggag
tgtcccaaccccaaaccagacaaggccccactgcagaaggtttccctggccccaaactct
cgctactacctgagctgccccatggaatcccgccacgccacctactcatggcgccacaag
gagaacgtggagcagagctgcgaacctggtcaccagagccccaactgcatcctgttcatc
gagaacctcacggcgcagcagtacggccactacttctgcgaggcccaggagggctcctac
ttccgcgaggctcagcactggcagctgctgcccgaggacggcatcatggccgagcacctg
ctgggtcatgcctgtgccctggccgcctccctctggctgggggtgctgcccacactcact
cttggcttgctggtccactag

DBGET integrated database retrieval system