KEGG   Homo sapiens (human): 8483
Entry
8483              CDS       T01001                                 
Symbol
CILP, CILP-1, HsT18872
Name
(RefSeq) cartilage intermediate layer protein
  KO
K24436  cartilage intermediate layer protein
Organism
hsa  Homo sapiens (human)
Disease
H02539  Intervertebral disc disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8483 (CILP)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Thrombospondin domain-containing proteins
  Other thrombospondin domain-containing proteins
   8483 (CILP)
SSDB
Motif
Pfam: Mucin2_WxxW Ig_3 Ig_2 TSP_1 CarbopepD_reg_2 CarboxypepD_reg I-set TSP1_spondin ig
Other DBs
NCBI-GeneID: 8483
NCBI-ProteinID: NP_003604
OMIM: 603489
HGNC: 1980
Ensembl: ENSG00000138615
Pharos: O75339(Tbio)
UniProt: O75339
Position
15:complement(65194760..65211473)
AA seq 1184 aa
MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAE
MVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
AAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVLTMPKTSLKAATIK
AEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLLDPSLYKHESK
LVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKEC
SCQRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLT
FVDRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAE
LEIPSRSFYRQNGEPYIGKVKASVTFLDPRNISTATAAQTDLNFINDEGDTFPLRTYGMF
SVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEGDFKFENQR
RNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINL
EPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLR
ACEEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKI
VGPLEVNVRSRNMGGTHRQTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRV
DRTLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVT
DQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPAQS
PAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN
NT seq 3555 nt   +upstreamnt  +downstreamnt
atggtggggaccaaggcctgggtgttctccttcctggtcctggaagtcacatctgtgttg
gggagacagacgatgctcacccagtcagtaagaagagtccagcctgggaagaagaacccc
agcatctttgccaagcctgccgacaccctggagagccctggtgagtggacaacatggttc
aacatcgactacccaggcgggaagggcgactatgagcggctggacgccattcgcttctac
tatggggaccgtgtatgtgcccgtcccctgcggctagaggctcggaccactgactggaca
cctgcgggcagcactggccaggtggtccatggtagtccccgtgagggtttctggtgcctc
aacagggagcagcggcctggccagaactgctctaattacaccgtacgcttcctctgccca
ccaggatccctgcgccgagacacagagcgcatctggagcccatggtctccctggagcaag
tgctcagctgcctgtggtcagactggggtccagactcgcacacgcatttgcttggcagag
atggtgtcgctgtgcagtgaggccagcgaagagggtcagcactgcatgggccaggactgt
acagcctgtgacctgacctgcccaatgggccaggtgaatgctgactgtgatgcctgcatg
tgccaggacttcatgcttcatggggctgtctcccttcccggaggtgccccagcctcaggg
gctgctatctacctcctgaccaagacgccgaagctgctgacccagacagacagtgatggg
agattccgaatccctggcttgtgccctgatggcaaaagcatcctgaagatcacaaaggtc
aagtttgcccccattgtactcacaatgcccaagactagcctgaaggcagccaccatcaag
gcagagtttgtgagggcagagactccatacatggtgatgaaccctgagacaaaagcacgg
agagctgggcagagcgtgtctctgtgctgtaaggccacagggaagcccaggccagacaag
tatttttggtatcataatgacacattgctggatccttccctctacaagcatgagagcaag
ctggtgctgaggaaactgcagcagcaccaggctggggagtacttttgcaaggcccagagt
gatgctggggctgtgaagtccaaggttgcccagctgattgtcatagcatctgatgagact
ccttgcaacccagttcctgagagctatcttatccggctgccccatgattgctttcagaat
gccaccaactccttctactatgacgtgggacgctgccctgttaagacttgtgcagggcag
caggataatgggatcaggtgccgtgatgctgtgcagaactgctgtggcatctccaagaca
gaggaaagggagatccagtgcagtggctacacgctacccaccaaggtggccaaggagtgc
agctgccagcggtgtacggaaactcggagcatcgtgcggggccgtgtcagtgctgctgac
aatggggagcccatgcgctttggccatgtgtacatggggaacagccgtgtaagcatgact
ggctacaagggcactttcaccctccatgtcccccaggacactgagaggctggtgctcaca
tttgtggacaggctgcagaagtttgtcaacaccaccaaagtgctacctttcaacaagaag
gggagtgccgtgttccatgaaatcaagatgcttcgtcggaaaaagcccatcactttggaa
gccatggagaccaacatcatccccctgggggaagtggttggtgaagaccccatggctgaa
ctggagattccatccaggagtttctacaggcagaatggggagccctacataggaaaagtg
aaggccagtgtgaccttcctggatccccggaatatttccacagccacagctgcccagact
gacctgaacttcatcaatgacgaaggagacactttcccccttcggacgtatggcatgttc
tctgtggacttcagagatgaggtcacctcagagccacttaatgctggcaaagtgaaggtc
caccttgactcgacccaggtcaagatgccagagcacatatccacagtgaaactctggtca
ctcaatccagacacagggctgtgggaggaggaaggtgatttcaaatttgaaaatcaaagg
aggaacaaaagagaagacagaaccttcctggtgggcaacctggagattcgtgagaggagg
ctctttaacctggatgttcctgaaagcaggcggtgctttgttaaggtgagggcctaccgg
agtgagaggttcttgcctagtgagcagatccagggggttgtgatctccgtgattaacctg
gagcctagaactggcttcttgtccaaccctagggcctggggccgctttgacagtgtcatc
acaggccccaacggggcctgtgtgcctgccttctgtgatgaccagtcccctgatgcctac
tctgcctatgtcttggcaagcctggctggggaggaactgcaagcagtggagtcttctcct
aaattcaacccaaatgcaattggcgtccctcagccctatctcaacaagctcaactaccgt
cggacggaccatgaggatccacgggttaaaaagacagctttccagattagcatggccaag
ccaaggcccaactcagctgaggagagcaatgggcccatctatgcctttgagaacctccgg
gcatgtgaagaggcaccacccagtgcagcccacttccggttctaccagattgagggggat
cgatatgactacaacacagtccccttcaacgaagatgaccctatgagctggactgaagac
tatctggcatggtggccaaagccgatggaattcagggcctgctatatcaaggtgaagatt
gtggggccactggaagtgaatgtgcgatcccgcaacatggggggcactcatcggcagaca
gtggggaagctgtatggaatccgagatgtgaggagcactcgggacagggaccagcccaat
gtctcagctgcctgtctggagttcaagtgcagtgggatgctctatgatcaggaccgtgtg
gaccgcaccctggtgaaggtcatcccccagggcagctgccgtcgagccagtgtgaacccc
atgctgcatgagtacctggtcaaccacttgccacttgcagtcaacaacgacaccagtgag
tacaccatgctggcacccttggacccactgggccacaactatggcatctacactgtcact
gaccaggaccctcgcacggccaaggagatcgcgctcggccggtgctttgatggcacatcc
gatggctcctccagaatcatgaagagcaatgtgggagtagccctcaccttcaactgtgta
gagaggcaagtaggccgccagagtgccttccagtacctccaaagcaccccagcccagtcc
cctgctgcaggcactgtccaaggaagagtgccctcgaggaggcagcagcgagcgagcagg
ggtggccagcgccagggtggagtggtggcctctctgagatttcctagagttgctcaacag
cccctgatcaactaa

DBGET integrated database retrieval system