KEGG   Homo sapiens (human): 84830Help
Entry
84830             CDS       T01001                                 

Gene name
ADTRP, AIG1L, C6orf105, dJ413H6.1
Definition
(RefSeq) androgen dependent TFPI regulating protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Far-17a_AIG1 MPS-4
Motif
Other DBs
NCBI-GeneID: 84830
NCBI-ProteinID: NP_116133
OMIM: 614348
HGNC: 21214
Ensembl: ENSG00000111863
Vega: OTTHUMG00000014260
Pharos: Q96IZ2(Tbio)
UniProt: Q96IZ2
Position
6p24.1
AA seq 230 aa AA seqDB search
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagacttctacatgcatataccacttccttgttctgagctggtatactttcctc
aattattacatctcacaggaaggaaaagacgaggtgaaacccaaaatcttggcaaatggt
gcaaggtggaaatatatgacgctgcttaatctgctcttgcagaccattttctacggggtc
acctgcctggatgatgtgctgaaaagaaccaaagggggaaaagacattaagttcctaact
gccttcagagacctgcttttcaccactctggcttttcctgtatccacgtttgtatttttg
gcattctggatcctctttctctacaatcgagatctcatttaccccaaggtcctagatact
gtcatccccgtgtggctgaatcatgcaatgcacactttcatattccccatcacattggct
gaagtcgtcctcaggcctcactcctatccatcaaagaagacaggactcaccttgctggct
gctgccagcattgcttacatcagccgcatcctatggctctactttgagacgggtacctgg
gtgtatcctgtgtttgccaaactcagcctcttgggtctagcagctttcttctctctcagc
tacgtcttcatcgccagcatctacctacttggagagaagctcaaccactggaaatggggt
gacatgaggcagccacggaagaagaggaagtaa

DBGET integrated database retrieval system