KEGG   Homo sapiens (human): 84836
Entry
84836             CDS       T01001                                 
Symbol
ABHD14B, CIB, HEL-S-299
Name
(RefSeq) abhydrolase domain containing 14B
  KO
K13706  abhydrolase domain-containing protein 14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84836 (ABHD14B)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   84836 (ABHD14B)
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_11 DLH
Other DBs
NCBI-GeneID: 84836
NCBI-ProteinID: NP_001139786
HGNC: 28235
Ensembl: ENSG00000114779
Pharos: Q96IU4(Tdark)
UniProt: Q96IU4 V9HW87
Structure
Position
3:complement(51968510..51974630)
AA seq 210 aa
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQA
GYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPF
LTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRV
LIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcagcaagcgtggagcagcgcgagggcaccatccaggtgcagggccaggccctcttc
ttccgagaggccctgcccggcagtgggcaggctcgcttctctgtactgctgctgcatggt
attcgcttctcctccgagacctggcagaacctgggtacactgcacaggctggcccaggct
ggctaccgggctgtggccattgacctgccaggtctggggcactccaaggaagcagcagcc
cctgcccctattggggagctggcccctggcagcttcctggcggctgtggtggatgccttg
gagctgggccccccggttgtgatcagtccatcactgagtggcatgtactccctgcccttc
ctcacggcccctggctcccagctcccgggctttgtgccagtggcccccatctgcactgac
aaaatcaatgctgccaactatgccagtgtgaagactccagctctgattgtatatggagac
caggaccccatgggtcagaccagctttgagcacctgaagcagctgcccaaccaccgggtg
ctgatcatgaagggggcggggcacccctgttacctggacaaaccagaggagtggcataca
gggctgctggacttcctgcaggggctccagtga

DBGET integrated database retrieval system