KEGG   Homo sapiens (human): 84866Help
Entry
84866             CDS       T01001                                 

Gene name
TMEM25
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    84866 (TMEM25)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  TMEM25
   84866 (TMEM25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 84866
NCBI-ProteinID: NP_116169
OMIM: 613934
HGNC: 25890
Ensembl: ENSG00000149582
Vega: OTTHUMG00000166339
Pharos: Q86YD3(Tdark)
UniProt: Q86YD3
Position
11q23.3
AA seq 366 aa AA seqDB search
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIVV
AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVS
SDEIWL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcctccaggcccagccgccctccggcacacactgctgctcctgccagccctt
ctgagctcaggttggggggagttggagccacaaatagatggtcagacctgggctgagcgg
gcacttcgggagaatgaacgccacgccttcacctgccgggtggcaggggggcctggcacc
cccagattggcctggtatctggatggacagctgcaggaggccagcacctcaagactgctg
agcgtgggaggggaggccttctctggaggcaccagcaccttcactgtcactgcccatcgg
gcccagcatgagctcaactgctctctgcaggaccccagaagtggccgatcagccaacgcc
tctgtcatccttaatgtgcaattcaagccagagattgcccaagtcggcgccaagtaccag
gaagctcagggcccaggcctcctggttgtcctgtttgccctggtgcgtgccaacccgccg
gccaatgtcacctggatcgaccaggatgggccagtgactgtcaacacctctgacttcctg
gtgctggatgcgcagaactacccctggctcaccaaccacacggtgcagctgcagctccgc
agcctggcacacaacctctcggtggtggccaccaatgacgtgggtgtcaccagtgcgtcg
cttccagccccagggcttctggctacccgggtggaagtgccactgctgggcattgttgtg
gctgctgggcttgcactgggcaccctcgtggggttcagcaccttggtggcctgcctggtc
tgcagaaaagagaagaaaaccaaaggcccctcccggcacccatctctgatatcaagtgac
tccaacaacctaaaactcaacaacgtgcgcctgccacgggagaacatgtccctcccgtcc
aaccttcagctcaatgacctcactccagattccagagcagtgaaaccagcagaccggcag
atggctcagaacaacagccggccagagcttctggacccggagcccggcggcctcctcacc
agccaaggtttcatccgcctcccagtgctgggctatatctatcgagtgtccagcgtgagc
agtgatgagatctggctctga

DBGET integrated database retrieval system